KEGG   Neisseria gonorrhoeae FA 1090: NGO0545Help
Entry
NGO0545           CDS       T00237                                 

Definition
type III restriction-modification system methyltransferase (EC:3.1.21.5)
Orthology
K07316  
adenine-specific DNA-methyltransferase [EC:2.1.1.72]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Brite
Enzymes [BR:ngo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     NGO0545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
518016..520079
Genome map
AA seq 687 aa AA seqDB search
MLPTQPNPTQPNPTQPNPTQPNPSPDLSDTAGANTEAIYTSDGITANSTQLEQLKKLFPA
CFDADGNFLIDRLQAEIAPQTDIGREFYEMNWLGKSYARLLRNLPPETLISEDKTHNAKP
ENAGSQNLLIRGDNLEVLKHLKNAYANSVKMIYIDPPYNTGSDGFVYQDDRKFTPAELAL
LANIDEDEAARILDFTDKGSNSHSAWLTFMYPRLYIARELLKDDGVIFISIDDNEAAQLK
LLCDEVFGEGNFVAQLPWRKRTAKSDVPFGISQDYEWIFVFAKSCQFIAATKGKERRYYE
TDDFPDRPWRTHDLTKQTTAAERPNSFFTMVDPKTGKKYPANPNATWRVTKDTFQDYYNK
GKIVFPDDYDFLNISNPVMRYFKDDDMKKAGEDFGKVAVSSRLPENVGTLADAVAEYLAI
FSRTLPENIGMTKEGTKEITDLFGSKIFTFPKPSQLIKFLVSISSKSNDLILDFFAGSGT
TAHAVMQLNAEGQNGNRRYICVQLPEKTAEKSEARKAGYPTIFDITKARIEKAAAKIRVE
HPDYTGDSGFKIFQTADNFRQHPDKDFSPEQPDLPLNDELSEEQLQTLLTTWTLYDGAAL
TTPVEPVRLGSYTAYLCEKRLYLLNKGFTSADLLAFIKKLDDDADFNPNRVIVFGSNMAS
AMQHELDQAVRGYTNKKEIELNVIIRV
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgctgccaacccaacccaacccaacccaacccaacccaacccaacccaacccaacccaa
cccaacccaagccctgatctaagcgacacagccggggcgaacactgaggcaatctacact
tcagacggcattaccgccaactctacccaactcgaacagctcaaaaaactgtttcccgcc
tgttttgacgcagacggaaatttccttatcgacagattacaagccgaaattgcgccacag
accgacatcggacgcgaattttacgaaatgaactggctgggcaaatcatatgcccgcctg
cttcgcaacctgccgcccgaaaccctgataagtgaagacaaaacgcacaacgccaagccc
gaaaatgcaggcagccaaaatctgctgattcgcggcgataatctggaagtgttgaaacac
ttaaaaaacgcctacgcaaacagcgtgaagatgatttacatcgacccgccctacaacacc
ggatcggacggctttgtctatcaggacgaccgcaaattcacacccgccgaacttgccctc
ctggcgaatattgacgaagacgaagccgcgcggattttagatttcaccgacaaaggctca
aactcgcacagcgcgtggctgacctttatgtatccgcgcctgtatatcgcccgcgaactg
ttaaaggacgacggcgtgatttttatctcgattgacgataacgaagcggcgcagttgaaa
ttgttgtgtgatgaagtgtttggggaagggaattttgttgcacaattgccttggcgaaaa
agaacagctaaatcagatgtgccttttggtatttcgcaggattatgaatggatatttgta
ttcgcaaaatcttgccaatttattgcagcaactaaaggcaaggaacgacgctattatgag
actgatgatttccccgatcgtccttggcgtacccacgacttaacgaaacaaacaactgcg
gcggaaaggccaaatagttttttcacaatggttgatcccaagacaggaaaaaaatatcca
gcaaatccaaatgcaacttggcgtgtaaccaaagatacatttcaagattattataataaa
ggaaaaatcgttttccctgatgattatgatttcttaaatatcagcaatccagttatgcgt
tactttaaagatgacgacatgaaaaaagctggcgaggattttggcaaagtagctgtaagc
agtagattacctgaaaatgttggtacattagccgatgcagtagccgaatatttggctatt
tttagtaggacgctacctgaaaatatcggaatgactaaagaaggcacaaaagaaatcaca
gatttatttggtagcaaaatatttaccttccccaagcctagtcaattgattaaattttta
gtttcaataagttcaaagagtaatgacctaatcctagacttcttcgcaggcagcggcaca
accgcccacgccgtgatgcagcttaacgccgaaggacaaaacggtaaccgccgctatatc
tgtgtacagcttcccgaaaaaaccgctgaaaaatccgaagcccgtaaagcaggctacccg
accatcttcgacatcaccaaagcccgcatagaaaaagccgccgccaaaatccgcgtcgaa
catcccgattacacgggcgattccggcttcaaaatctttcaaacggcagacaatttcagg
cagcatccagacaaggatttttcgcccgaacaaccggatttgccgcttaacgatgaatta
agcgaagaacagctgcaaacgcttctgaccacctggacgctgtatgacggggcggcactg
accacgccggttgagcctgtgcggttgggcagttatacggcgtatctgtgcgaaaaacgg
ctgtatctgcttaacaagggttttacttccgccgatttgctggcgtttatcaagaagctg
gacgacgatgcggatttcaatcccaaccgtgtgattgtattcggcagcaatatggcaagc
gccatgcagcacgaactcgaccaggcggttcgcggttataccaataaaaaagagattgag
ttgaatgtgattatcagggtgtaa

DBGET integrated database retrieval system