KEGG   Neisseria gonorrhoeae FA 1090: NGO0546Help
Entry
NGO0546           CDS       T00237                                 

Definition
type III restriction-modification system endonuclease (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Brite
Enzymes [BR:ngo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     NGO0546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
520169..523108
Genome map
AA seq 979 aa AA seqDB search
MSGFNYEKNQPHQMRAVSAVLGVFDGATPKYRTADENPELLFAAKQYANNILKVQSQNGI
DGRFPDRSDDQNILDISMETGTGKTYTYTQTMFELHRWLGVFKFIVVVPTLSIKAGTQQF
LQSKALAEHFEQDFGGDYEGVRLKTYVVESAKKNKGKKSNAPITIEQFVKAENKKEIHVL
LINAGMVNSSSMNDTGDKALKDLFDNPVDALAAVRPFMIVDEPHKFPTRDSAKTWGNIKR
LKPQYILRYGATFNDEYYNLLYRLTAVDAFNDGLVKGVRVFQEEMQGGMDAAVKLVSSDG
KEAKFELNEKDKKQTFKLAKGEDLAQIHPAISDLKIDKMNKTVVVLSNGLELKTGAVINP
YSYSQTVQDAMMQRAVAEHFKLERALLAERAPQPKIKPLTLFFIDDIAGYRSGNELSGSL
KDKFESWIRAEAARRLKTESDPFYRDYLQKTLDDVSACHGGYFSKDNTDSDDRIEQEINE
ILHDKEKLLSLDNPRRFIFSKWTLREGWDNPNVFQICKLRSSGSTTSKLQEVGRGLRLPV
NELMARVRDVPYKLNYFVDSSEKDFVKQLVGEINDNSFQEEISKKFTEELKQKILQKYPD
IKPLVLVNQLFSDGIIDDNENFAEDGYDKLKAAYPEAFPKGLDKGKVSNAKDEGKDTIIM
REGKYEELKALWELIHHKAVLQYKIKDEAEFVDLFTAYLRENAAKFPQAGICTAVNEAYI
NNGLMLSRRIDSIEDEDFIRFNTMTYREFLEKLAQTAKIQMQTLHQAFYRVRDELNIGDF
LNMQTIAQIKNGFNRFLLHHSFHKFELDYRLVGSKIHPTKFTNKDGKPRAVKKADLGRFE
DTEHRPAAGYLFGEIFYDSDIEHENVANNQIEGVIVFTKIPRNSIKIPVAGGGTYSPDFA
YIVKTKSGEILNFVIEAKGTDGAEDLRKSEERKIKHAEKLFAEISKEIKVVFKTQFDGER
IAELIGQNMPAGGHSENGH
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atgagcggttttaattacgagaaaaaccagccgcaccaaatgcgggcggtttcggcggtt
ttgggcgtgtttgacggggcaacgcccaaatatcggacggcagacgaaaatcccgaactt
ttgtttgctgcaaaacaatacgcaaacaatatcctgaaagtgcaaagccaaaacggtata
gacggccgattccccgaccgttcggacgaccaaaatatccttgatatttccatggaaacg
ggcacgggcaaaacctatacctacacacaaaccatgttcgagctgcaccgttggctgggc
gtgttcaaatttatcgtggtcgtgccgactttgtccattaaggcgggaacacagcagttt
ttgcaaagcaaggctttggcagagcattttgaacaggatttcggcggcgattatgaaggc
gtacgcctgaaaacctatgtggtggaaagcgcgaaaaagaataagggcaaaaagtccaat
gcgcccataacgattgagcaatttgtcaaagcggaaaacaaaaaggaaattcatgtgctg
ctgattaacgcgggcatggttaattcgtcgtccatgaacgatacgggcgacaaggcattg
aaggatttgtttgacaatcccgttgatgcattggctgccgtgcgcccgtttatgattgtg
gacgaaccgcataaattcccgacccgagatagcgcgaaaacgtggggcaatatcaaacgc
ttaaaaccgcaatatattttgcgctacggtgcaacatttaacgatgaatattacaacttg
ctttaccgtttgacggcagtagacgcgtttaacgacgggctggtcaaaggcgtgcgcgtg
tttcaggaagaaatgcagggcggcatggatgcggcggtaaaactggtgtcgtcggacggc
aaagaagcgaaatttgaattaaacgaaaaggacaaaaagcagacgttcaaactggcaaaa
ggcgaagatttggcgcaaatccatccggctatttcggatttgaaaatcgacaaaatgaat
aaaaccgtggtggtgttaagcaacggcttggagttgaaaacgggtgccgtcatcaaccct
tattcctattcgcaaacggtgcaggatgcgatgatgcagcgggcggttgccgaacatttc
aagctggaacgcgcgcttttggcagaacgcgcgccacagcccaaaatcaagccgctgacg
ctgttttttattgacgatatcgcgggctaccgcagcggcaacgagctttcaggcagcctg
aaagataaatttgaaagctggattcgcgcggaagcggcacgccgtctgaaaacggaaagc
gacccgttttaccgcgattacctgcaaaagacgttggacgatgtatccgcctgccacggc
ggctatttttccaaagacaatacagacagcgacgatagaatcgagcaggaaatcaatgaa
atcctgcacgataaggaaaaactgctgtctttggacaacccgcgccgctttattttttcc
aaatggacgctgcgcgaaggctgggacaatcccaacgttttccagatttgcaaactgcgt
tccagcggcagcacgacttccaagctgcaagaagtcggacgcggcctgcgcctgccggta
aacgagctgatggcgcgggtgcgcgatgtaccgtacaaactgaattattttgtcgatagc
agcgaaaaagactttgtgaagcagcttgtcggcgaaatcaacgacaattcttttcaggaa
gaaatctccaaaaagtttaccgaagagctgaaacaaaaaatattgcaaaaataccccgat
atcaaaccgctggtattggtaaaccaactgttttcagacggcatcattgacgacaatgaa
aactttgccgaagacggctatgacaaattaaaagccgcctatcccgaagccttccccaaa
ggtttggacaaaggcaaagtcagcaacgccaaagacgagggcaaagacaccatcatcatg
cgcgaaggcaaatatgaagaactcaaagccttgtgggagctgattcaccataaagccgtt
ttgcagtacaaaatcaaagatgaagccgaatttgtcgatttatttaccgcctatttgcgt
gaaaacgccgccaaattcccgcaggcaggcatatgcacggcggtaaacgaagcttatatc
aacaacgggcttatgctttcccgccgcatagacagtattgaagatgaagattttatccgt
ttcaacacaatgacttaccgtgagtttctggaaaaactggcacaaacggcaaaaatccag
atgcagactttgcatcaggcgttttaccgcgtccgcgacgaactgaacattggcgatttt
ttgaatatgcagaccatcgcccaaatcaaaaacggcttcaaccggtttttgcttcatcat
tccttccataaattcgaactggattaccggcttgtcggcagcaaaatccatccgaccaaa
tttaccaataaagacggcaaaccgcgcgcggtgaaaaaagcagatttgggcagatttgaa
gatacggagcaccggcctgccgccggctatctcttcggcgagattttctacgattcggat
atagaacatgaaaatgtcgccaacaaccaaattgaaggcgtaatcgtatttaccaaaata
ccgagaaactccatcaaaatccctgttgccggcggcggcacgtattcgcccgactttgcc
tatatcgtgaaaaccaaaagcggcgagattctgaactttgtgattgaagccaaagggact
gacggggcggaagatttgcgaaaaagcgaagagcggaaaatcaaacatgccgaaaagctg
tttgccgagatttccaaagaaatcaaggtggtgttcaaaacgcagtttgacggcgagagg
atagccgaactgatcgggcaaaatatgccagcaggcgggcattctgaaaacggacactga

DBGET integrated database retrieval system