KEGG   Neisseria gonorrhoeae FA 1090: NGO0610Help
Entry
NGO0610           CDS       T00237                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ngo03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
597525..598352
Genome map
AA seq 275 aa AA seqDB search
MPELPEVETTLRGIAPHIEGKTVEAVILRQLKLRWQINPDLGEILSGRQVLSCGRRAKYL
IVRFQTGILLIHLGMSGSLRIFTPSDGRIGRPDRHDHVDIVFSDGTVMRYRDPRKFGAIL
WYEGIEERHPLLEKLGPEPLSEAFCTDYLYAGLKAQKRAVKLALMDNTVVVGVGNIYANE
SLFRAGISPHRPANRLKKKECAVLVETVKAVLQRAIETGGSTLRDFVDSDGKSGYFQQEY
TVYGRHNQPCLRCGGLVVKETLGQRGTFYCTNCQK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattgccggaagtggaaacgacgttgcgcggcatcgcgccgcatattgaagga
aaaacggtggaagccgtgatattgcgccaactgaagctgcgctggcagatcaatcccgat
ttgggggagattttgtccggccggcaggttttgtcctgcggcaggcgtgccaaatatctg
attgtccgtttccaaacggggattttgctgattcacttggggatgtcgggcagcttgcgg
atctttacgccgtcggacggacgtatcggcaggccggacagacacgatcacgtcgatatt
gtgttttcagacggcacggtcatgcgttaccgcgatccgagaaagttcggcgcgatactt
tggtatgagggaatcgaagaacgtcatccgctgttggaaaaactggggccggagcctttg
tcggaggcattttgcacggattatctgtatgcggggctgaaggcgcagaaacgcgcggtc
aaactcgctctgatggacaataccgtcgtggtcggcgtgggcaatatttatgccaacgag
agtctgttcagggcgggcatttcgccccaccgtcctgccaaccgcctaaaaaagaaagag
tgcgcggttttggttgaaaccgtcaaagcggtgttgcagcgcgccattgaaacgggcggc
agtacgctgagggattttgtggacagcgacggcaaaagcggctactttcaacaggaatat
acggtgtacgggcggcacaatcagccgtgcctccggtgcggcggtttggttgtgaaagaa
actttggggcagcgcggcacgttttattgcacgaactgtcagaaatag

DBGET integrated database retrieval system