KEGG   Neisseria gonorrhoeae FA 1090: NGO0689Help
Entry
NGO0689           CDS       T00237                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ngo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NGO0689
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NGO0689
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NGO0689
Enzymes [BR:ngo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NGO0689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(679478..680887)
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGETAHKPFSEVLLMGLAPDGGLMLPEHYPQIGRETLDKWRGLAYPELAFEIMC
LFVTDIPEDDLRDILNRTYTEAAFGTKEITPVRTLSDGIKIQALSNGPTLAFKDMAMQFL
GNAFEYVLNKEGKKLNILGATSGDTGSAAEYALRGKKGVNVFMLSPDGKMSAFQRAQMYS
LQDGNIHNIAVKGMFDDCQDIVKAVQNDAAFKEKYHIGTVNSINWGRIVAQVVYYFAGYF
NATSSNDETVSFCVPSGNFGNVCAGHIAKQMGLPVRCLIVATNENDVLDEFFKTGAYRPR
NSAHTYVTSSPSMDISKASNFERFVFDLMDRDPQEINTLWAEVAAGKGFDLRFALDKVGG
KYGFTSGKSTHADRLATIRQVYEQDKELIDPHTANGVKVAREVREAGETVVCLETALAAK
FDATIREAVGDVAIPRPAALEGLENLPQRVQTVPNSADAVKGIIEQTLA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgagatacatcagcacgcgcggcgaaaccgcacacaaaccgttcagcgaagttttattg
atggggcttgcacccgacggcggactgatgctgccggaacattatccgcaaatcgggcgc
gaaaccttggacaaatggcgcggtttggcttatcccgaattggcgtttgaaatcatgtgc
ctgttcgttaccgatattccggaggacgatttgcgcgacattctgaaccgtacttacacg
gaagcggcgttcggtactaaggaaatcacccccgtccgcacgctttcagacggcatcaaa
atccaagccttgtccaacggcccgacgctggcgttcaaagatatggcgatgcagtttttg
ggcaatgcgtttgaatatgttttaaacaaagaaggcaaaaaactcaatatcttgggcgca
accagcggcgatacgggttcggctgcggaatatgccttgcgcggcaaaaaaggcgtgaac
gtatttatgttgtcgcccgacggtaaaatgagcgcgttccaacgcgcgcagatgtacagc
ctgcaagacgggaatatccacaatatcgccgtgaaggggatgtttgacgactgccaggac
attgtgaaggcagtgcagaacgatgccgcgttcaaggaaaaataccatatcggtacggtc
aattcgatcaactgggggcgcatcgtcgcgcaagtggtttattactttgcaggctatttc
aatgccacttcaagcaatgacgaaaccgtcagcttttgcgtaccgagcggcaacttcggc
aacgtttgcgcgggacacatcgccaaacaaatgggcctgcctgtccgctgcctgattgtc
gcgaccaatgaaaacgatgtgctggacgagtttttcaaaaccggcgcataccgcccgcgc
aacagcgcgcatacttatgtaacctccagcccgtctatggacatttccaaagcgtccaac
ttcgagcgtttcgtgttcgacctgatggatcgcgatcctcaggaaatcaatacgctgtgg
gcggaagtcgcggcaggcaaaggctttgacctgcggtttgccttggacaaagtcggcggc
aaatacggctttacctccggcaaatctacccacgccgaccgcctcgccaccatcagacag
gtttacgagcaagacaaagaactcatcgacccgcatactgccaacggcgtaaaagtcgcc
cgcgaagtgcgcgaagcgggggaaacggtggtttgtttggaaaccgcgttggcggcgaaa
ttcgatgcgaccatacgcgaagccgtcggcgatgtcgccattccgcgccccgccgcgctg
gaaggtttggaaaacctgccgcagcgcgtgcaaaccgtgccgaacagtgcggatgcggta
aaaggcatcatcgaacaaacccttgcctga

DBGET integrated database retrieval system