KEGG   Neisseria gonorrhoeae FA 1090: NGO0711Help
Entry
NGO0711           CDS       T00237                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K18369  alcohol dehydrogenase [EC:1.1.1.-]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
ngo00640  Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:ngo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NGO0711
Enzymes [BR:ngo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     NGO0711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 3282111
NCBI-ProteinID: YP_207843
Position
710377..711393
Genome map
AA seq 338 aa AA seqDB search
MKAMVYHGANDIRFEEKPRPQIIDPTDAVVKIVKTTICGTDLGIWKGKNPEVADGRILGH
EGIGIVEEVGEAVKNIKVGDKVIISCVSKCCTCDNCKIQLYSHCRNGGWILGYMIDGTQA
EYVRTPYADNSLVPPHDNVNEEIALLLSDALPTAHEIGVQYGDVKPGDTVFIAGAGPVGM
SALLTAQLYSPAAIIVCDMDENRLKPAKELGATHTISPASGDVSKQVFAIVGEDGVDCAI
EAVGIPATWNMCQDIVKPGGHIAVVGVHGQSVDFKLEKLWIKNLAITTGLVNANTTEILM
KAIFSSSVDYTKMLTHRFKFSQLEKPTTCSNTPPKTKR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaatggtttatcacggcgcaaacgacatccgttttgaagaaaaaccccgcccg
cagattatcgatccgaccgatgcggtggtgaaaatcgtcaaaaccacgatttgcggtacc
gacttgggtatttggaaaggcaaaaaccccgaagtcgccgacggtcgtatcctcggtcat
gaaggcatcggtattgtagaagaagtcggcgaggctgtaaaaaacatcaaagtcggcgat
aaagtcattatttcatgcgtcagcaaatgctgcacttgcgacaactgcaaaatccaactt
tattcgcactgccgcaacggcggctggattttgggctatatgattgacggcacgcaggcc
gaatacgtccgcacgccttatgccgacaacagcctcgtgccgccgcacgacaacgtcaac
gaagaaatcgccctgctgttgagcgacgctttaccgaccgcccacgaaatcggcgtgcaa
tacggcgatgtgaaacccggcgataccgtattcatcgcaggtgccggccctgtcggtatg
tccgccttgttgaccgcccaactgtatagccctgccgccattatcgtgtgcgatatggac
gaaaaccgtttgaaaccggcgaaagagttgggcgcgacccataccatcagccccgcttcc
ggcgacgtctccaaacaagttttcgccatcgtcggcgaagacggcgtagattgtgccatc
gaagcggtcggtatccctgcaacttggaatatgtgccaagacatcgtgaaacccggcggt
catatcgccgtcgtcggcgtacacggtcaatccgttgatttcaaactggaaaaactgtgg
attaaaaatcttgccatcactaccggtttggtcaatgccaacaccaccgaaatactgatg
aaggcaattttcagcagctcagtggattacaccaaaatgttgacccaccgtttcaaattc
agccaattggaaaagcctacgacgtgttcaaacacgccgccgaaaaccaagcgatga

DBGET integrated database retrieval system