KEGG   Neisseria gonorrhoeae FA 1090: NGO0717Help
Entry
NGO0717           CDS       T00237                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ngo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NGO0717 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGO0717 (glk)
   00052 Galactose metabolism
    NGO0717 (glk)
   00500 Starch and sucrose metabolism
    NGO0717 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    NGO0717 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NGO0717 (glk)
   00524 Butirosin and neomycin biosynthesis
    NGO0717 (glk)
Enzymes [BR:ngo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NGO0717 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
717487..718473
Genome map
AA seq 328 aa AA seqDB search
MSSTPNKHADYPRLVADIGGTNARFALETAPCVIEKVAVLPCKEYDTVTDAVRAYLNQSG
ATGVRHAAFAIANPILGDWVQMTNHHWAFSIETTRQALGLDTLILLNDFTAQALAVTQTS
SKDLMQVGGQKPVEFAPKAVIGPGTGLGVSGLVHSPAGWVALAGEGGHTSFPPFDDMEVL
IWQYAKNKYRHVSAERFLSGAGLSLIYETLAVKQKAEPAKLMPSEITEKALNCESPLCRQ
ALDIFCAMLGTVASNLALTLGARGGVYLCGGIIPRMLDYFKTSPFRSRFENKGRFEAYLA
AIPVYVVLSEFPGIAGAAAALGNHLKNV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctacgccgaataaacacgccgattacccgaggctggttgccgacatcggcggc
acaaacgcccgtttcgcattggaaaccgcgccgtgcgtgattgagaaagtcgccgtcctg
ccgtgtaaggaatacgacacggttaccgacgcggtgcgtgcctatctgaaccaaagtggt
gcaacgggcgtacggcacgcggcatttgccatcgccaacccgattttgggcgactgggtg
cagatgaccaaccaccattgggcgttttccatcgaaaccacccgtcaggctttggggctg
gacaccctcatccttttgaacgactttaccgcgcaggcattggcggtaacgcagacttca
agcaaagacctgatgcaggtaggcgggcaaaagcctgtcgaattcgcccccaaggccgtt
atcggccccggtaccggcttgggcgtgagcggattggtgcacagccccgcaggctgggtg
gcgttggcgggcgagggcgggcataccagtttcccgccgtttgacgatatggaagtgttg
atttggcagtacgccaaaaacaaataccgccacgtttccgccgaacgtttcctcagcggc
gcaggtttgagcctgatttatgaaacgctggcggtcaagcagaaagccgaaccggcaaaa
ctgatgccgtctgaaattaccgaaaaggcattaaattgcgaatcgcccctgtgccggcag
gcattggacattttctgcgcgatgctgggcacggtcgcttccaacctcgccctgactttg
ggcgcgcgcgggggcgtgtatttgtgcggcggcattatcccgcgaatgttggattacttc
aaaacctcccccttccgcagccgctttgaaaacaaagggcgttttgaagcctaccttgcc
gcgattcccgtttatgtcgtcttgagcgaatttccgggtattgccggcgcggcggcggcg
ctcggcaaccacctgaaaaacgtctaa

DBGET integrated database retrieval system