KEGG   Neisseria gonorrhoeae FA 1090: NGO0767Help
Entry
NGO0767           CDS       T00237                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ngo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NGO0767 (recR)
DNA repair and recombination proteins [BR:ngo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      NGO0767 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
762109..762726
Genome map
AA seq 205 aa AA seqDB search
MNSKKQDAFQRLIGALKVLPNVGPKSAQRMAYHLLQQKRKEAEELVDALQTALRQVCHCA
RCNTFCEGGLCDICADETRDGRRLMVVHMPADVSNIEAANCHDGLYFVLMGQINTALGMD
VSAIALDRLAQRLDGGEIEEIIIATAFTAEGNATAYVLSEFFKNLPYKVSRLSQGIPLGG
ELEYVDAGTLAQAVYERRLIKEGGA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaattccaaaaaacaggatgcattccaacgcctgatcggtgcgctgaaagtattgccc
aacgtcgggccgaaatcggcacagcggatggcgtaccatctgttgcagcaaaagcgcaaa
gaggctgaagagctggtggatgccttacagacggcattgaggcaggtttgccattgcgca
aggtgcaatacattttgcgaaggcggattgtgcgatatttgtgccgatgaaacacgcgac
gggcggcggctgatggtggtgcatatgcctgccgacgtgtcgaatatagaagcggcaaac
tgccacgacgggctgtatttcgtcctgatggggcaaatcaatacggcattgggaatggac
gtatccgccatcgcattggacaggctggcgcaacggctggacggcggggaaatcgaagaa
atcattatcgcgaccgcctttaccgcagaaggcaatgccacagcgtatgtcctgtccgag
tttttcaaaaacctgccttacaaggtcagcaggctgtcgcagggcatcccattgggcggc
gaattggaatatgtcgatgcgggaacgctggcgcaagcggtgtacgaacggcgtctgatt
aaagaaggcggggcgtaa

DBGET integrated database retrieval system