KEGG   Neisseria gonorrhoeae FA 1090: NGO0767Help
Entry
NGO0767           CDS       T00237                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ngo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
762109..762726
Genome map
AA seq 205 aa AA seqDB search
MNSKKQDAFQRLIGALKVLPNVGPKSAQRMAYHLLQQKRKEAEELVDALQTALRQVCHCA
RCNTFCEGGLCDICADETRDGRRLMVVHMPADVSNIEAANCHDGLYFVLMGQINTALGMD
VSAIALDRLAQRLDGGEIEEIIIATAFTAEGNATAYVLSEFFKNLPYKVSRLSQGIPLGG
ELEYVDAGTLAQAVYERRLIKEGGA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaattccaaaaaacaggatgcattccaacgcctgatcggtgcgctgaaagtattgccc
aacgtcgggccgaaatcggcacagcggatggcgtaccatctgttgcagcaaaagcgcaaa
gaggctgaagagctggtggatgccttacagacggcattgaggcaggtttgccattgcgca
aggtgcaatacattttgcgaaggcggattgtgcgatatttgtgccgatgaaacacgcgac
gggcggcggctgatggtggtgcatatgcctgccgacgtgtcgaatatagaagcggcaaac
tgccacgacgggctgtatttcgtcctgatggggcaaatcaatacggcattgggaatggac
gtatccgccatcgcattggacaggctggcgcaacggctggacggcggggaaatcgaagaa
atcattatcgcgaccgcctttaccgcagaaggcaatgccacagcgtatgtcctgtccgag
tttttcaaaaacctgccttacaaggtcagcaggctgtcgcagggcatcccattgggcggc
gaattggaatatgtcgatgcgggaacgctggcgcaagcggtgtacgaacggcgtctgatt
aaagaaggcggggcgtaa

DBGET integrated database retrieval system