KEGG   Neisseria gonorrhoeae FA 1090: NGO0771Help
Entry
NGO0771           CDS       T00237                                 

Definition
(RefSeq) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
ngo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ngo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NGO0771
Enzymes [BR:ngo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     NGO0771
DNA repair and recombination proteins [BR:ngo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     NGO0771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 AAA_11 Helicase_RecD AAA_22 UvrD-helicase DUF2075 AAA_28 T2SSE UvrD_C AAA SRP54 AAA_5 NTPase_1 AAA_16 AAA_29 AAA_24 TrwB_AAD_bind Pox_A32 ATPase
Motif
Other DBs
NCBI-GeneID: 3282027
NCBI-ProteinID: YP_207898
UniProt: Q5F8K1
Position
765289..767034
Genome map
AA seq 581 aa AA seqDB search
MELQTDEFAQAAARAAIRFLERYAGSGNEVLANCTERLFQALQNGHSFIRLSGDEADALS
ALAPVVGTSAAPLILEGRRLFLGRMWQLEYDLAAEIKRLAAAGTSAPDAAGARQNLAKWF
QGAGSEGQRDAAALALLQFFMVITGGPGTGKTTTVAKLLALICGENENLPHIALAAPTGK
AAAHMARALHRSINGFDAPEAVRRHLLKLEGQTVHRLLKLSPPKMQAAFDHIRPLPFDVL
IVDEASMLDTALMLQLLKAVKTGARVILLGDENQLPSVGIGAVLSVLSQKTVLDGETHQR
LAGFLPEHGFSVSANPPVLAQNTAHLSFSHRFGDNSGIGCLARAAVSGDEGAWALFDRFP
DELEHSECSPNARVERLYRAHKAYWQAVKDGNIEAAYAGISDIVVLAAWRQDAEDFNEAY
CSYVRRKMNIPEHLAYFAGEPIMIRQNDYALELFNGDIGLIMEDVGRQGSLAAYFADADG
FKKVAVSCLPEFEPAFAMTVHKSQGSEYREVWLLPPSDAPSDEGDDALSGLSKELLYTAI
TRAREKFVFFGGKKTFCQAVNTVKVRQTALGSMLERVFSQE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggaactgcagacagatgaatttgcccaagcggcggcaagggcggcaatccgttttttg
gaacgctatgcgggttcgggcaacgaagtgcttgcaaactgtaccgaacgcctgtttcag
gcattgcaaaacggtcattcgtttatccgtttgagcggggacgaggctgacgcgctgtcg
gcactcgcacccgtggtcggaacatccgccgcgcctttgattttggaaggcagaaggctg
tttttgggcaggatgtggcagttggaatacgatttggctgccgaaataaaacgcttggcg
gcagccggcacgtccgcccccgacgcggcaggcgcgcggcaaaacctcgcaaaatggttt
caaggcgcgggaagcgaaggacagcgcgatgcggccgccttggcactgttgcagtttttt
atggtgattaccggagggccgggaacgggcaaaacgacaacggttgccaaactgctggca
ctgatttgcggtgaaaacgaaaatcttccccatatcgcgcttgccgcaccgacgggcaaa
gcggcggcacatatggcgcgcgcactgcaccgttcaatcaacggttttgacgcgccggag
gccgtccgccgccatttgctcaaactggaagggcaaaccgtccaccgactgcttaagctg
agcccgcccaaaatgcaggcggcgttcgaccatatccgtccgctgccgttcgacgtgctg
attgtcgatgaagcctccatgttggataccgcattgatgctgcaacttttgaaagcggtc
aaaaccggcgcgcgcgtgattctgctgggcgatgaaaaccagctcccgtccgtcggaatc
ggggcggtgctgtccgttttgtcgcaaaaaaccgttttggacggagaaacgcaccaaagg
ctggccggtttccttccggaacacggtttcagcgtcagcgcaaatccgcccgtgttggcg
caaaacaccgcccatctgtcgttcagccaccgcttcggcgacaacagcggcatcggctgc
cttgcccgtgccgccgtatcgggcgatgaaggggcgtgggcattgtttgaccggtttccg
gacgaactggaacattcggaatgcagtccgaatgctcgggtcgaaaggttgtaccgggcg
cacaaagcctattggcaggcggtaaaagacggcaatatcgaagccgcatacgcaggcatc
tcggatatcgtggttctggcagcttggcggcaggatgcggaagacttcaacgaagcctat
tgcagctatgtacgccgcaaaatgaacataccggaacatttggcctatttcgccggagag
ccgattatgatcagacagaacgactacgcgcttgagctgttcaacggcgacatcggactg
attatggaagatgtcggacggcagggcagccttgccgcctattttgccgatgcggacgga
tttaaaaaggtagcggtaagctgcctgcccgaatttgaacccgcattcgccatgaccgtc
cacaaaagccaaggttcggaatatcgggaagtctggctgctgccgccttccgacgcacct
tcggacgaaggggacgatgcattgtccggattgagtaaggagctgttatataccgccatt
acccgcgccagggaaaaattcgtatttttcggcggcaaaaagacattttgtcaggcggta
aacaccgtcaaagtccgtcagacggcgttgggcagtatgcttgagcgggtattttcacaa
gaataa

DBGET integrated database retrieval system