KEGG   Neisseria gonorrhoeae FA 1090: NGO1438Help
Entry
NGO1438           CDS       T00237                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Brite
Enzymes [BR:ngo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NGO1438
Secretion system [BR:ngo02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   NGO1438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1402283..1403068
Genome map
AA seq 261 aa AA seqDB search
MKTKLIKILTPFTVLPLLACGQTPVSNANAESAVKAESAGKSVAASLKARLEKTYSAQDL
KVLSVSETPVKGIYEVVVSGRQIIYTDAEGGYMFVGELINIDTRKNLTEERAADLNKIDF
ASLPLDKAIKEVRGNGKLKVAVFSDPDCPFCKRLEHEFEKMTDVTVYSFMMPIAGLHPDA
ARKAQILWCQPDRAKAWTDWMRKGKFPVGGSICDNPVAETTSLGEQFGFNGTPTLVFPNG
RTQSGYSPMPQLEEIIRKNQQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaagttaatcaaaatcttgaccccctttaccgtcctgccgctgctggcttgc
gggcaaacgcccgtttccaatgccaacgccgaatccgccgtcaaagccgaatccgccggc
aaatccgttgccgcttctttgaaagcgcgtttggaaaaaacctattccgcccaagatttg
aaagtgttgagcgtcagcgaaacaccggtcaaaggcatttacgaagtcgtcgtcagcggc
aggcagattatctacaccgatgccgaaggcggctatatgttcgtcggcgaactcatcaac
atcgacacgcgcaaaaacctgaccgaagaacgcgccgccgatttgaacaaaatcgacttc
gcctccctgcctttggacaaagccatcaaagaagtacgcggcaacggcaagctgaaagtc
gccgtcttctccgaccccgattgtccgttctgcaaacgcttggaacatgagtttgaaaaa
atgaccgacgtgacggtttacagctttatgatgcccattgccggcctgcacccagatgcc
gcgcgcaaggcgcaaatcttatggtgtcagcccgaccgtgccaaagcgtggacggattgg
atgcgtaaaggcaaattcccggtcggcggcagcatctgcgacaatcccgtcgcggaaacc
acttccttgggcgaacagttcggcttcaacggcacgccgaccctcgtcttccccaacggg
cgcacccaaagcggttacagcccgatgccccaactggaggaaatcatccgcaaaaaccag
cagtaa

DBGET integrated database retrieval system