KEGG   Neisseria gonorrhoeae FA 1090: NGO1442Help
Entry
NGO1442           CDS       T00237                                 

Gene name
adhA, adhP
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ngo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NGO1442 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGO1442 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    NGO1442 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    NGO1442 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NGO1442 (adhA)
   00626 Naphthalene degradation
    NGO1442 (adhA)
Enzymes [BR:ngo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NGO1442 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1407240..1408280
Genome map
AA seq 346 aa AA seqDB search
MQAVVVNKNVAGDVEVVEREVRPLEYGEALVEVEYCGVCHTDLHVAAGDYGEKPGRVLGH
EGIGLVKEVADGVKNLKVGDRVSIAWLFQSCGSCEYCNTGRETLCRSVLNAGYTADGGMA
THCIVSADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSGVRPGQWIAIYGAGGLGNLGV
QYAKKVFGTHVVAIDINDDKLAFAKETGADLVVNAAKEDAAKVIQEKTGGAHAAVVTAVS
AAAFNSAVNCVRAGGRVVAVGLPPESMDLSIPRLVLDGIEVVGSLVGTRKDLEEAFQFGA
EGLVVPKVQLRALDEAPAIFQEMREGKITGRMVIDMKKECGCDHHH
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcagttgttgtgaataaaaatgtagcgggcgatgtggaagtagtcgaacgcgag
gttcgcccgttggaatacggcgaggcattggtcgaagtcgaatattgcggcgtgtgccat
accgacctgcacgttgcggcaggcgactacggcgaaaaaccgggccgcgtgctgggacac
gagggcatcggtttggttaaagaagttgccgacggtgtgaaaaatctgaaagtcggcgac
cgcgtcagcatcgcctggctgttccaaagctgcggctcttgcgaatactgcaataccggc
cgcgaaaccctgtgccgttccgtattgaacgcgggctacaccgccgacggcggtatggcg
acccactgcatcgtgagtgccgattacgcggtcaaagtccctgaaggtttggatcctgcg
caagcttccagcattacttgtgccggcgtgaccacttataaagccattaaagtttccggc
gttcgtcctggtcaatggattgcgatttacggcgcgggcggcttgggcaacttgggtgtc
caatacgcgaaaaaagtattcggcacgcacgttgtcgccatcgacatcaacgacgacaag
ctggcatttgccaaagaaaccggcgcggatttggttgtcaacgccgccaaagaggacgct
gccaaagtgattcaggaaaaaaccggcggcgcacacgctgcggtcgtaaccgccgtatct
gctgccgcattcaactctgccgtgaattgcgtccgcgcgggcggacgtgtggttgccgtc
gggctgccgccggaatcgatggatttgtccatcccgcgtttggttttggacggcatcgaa
gtggtcggctctttggtcggcacgcgcaaagatttggaagaagccttccaattcggcgcg
gaaggtttggttgtgccgaaagtccaactgcgtgctttggatgaagcacccgccattttc
caagaaatgcgcgaaggcaaaatcaccggccgtatggtgatcgatatgaaaaaagaatgc
ggctgcgatcatcaccactga

DBGET integrated database retrieval system