KEGG   Neisseria gonorrhoeae FA 1090: NGO1492Help
Entry
NGO1492           CDS       T00237                                 

Definition
phospholipase
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NGO1492
   00565 Ether lipid metabolism
    NGO1492
   00590 Arachidonic acid metabolism
    NGO1492
   00591 Linoleic acid metabolism
    NGO1492
   00592 alpha-Linolenic acid metabolism
    NGO1492
Enzymes [BR:ngo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     NGO1492
    3.1.1.32  phospholipase A1
     NGO1492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1455598..1456746)
Genome map
AA seq 382 aa AA seqDB search
MPTMGAEMNTRNMRYILLTGLLPTASAFGETALQCAALTDNVTRLACYDRIFAAQLPSSA
GQEGQESKAVLNLTETVRSSLDKGEAVIVVEKGGDALPADSAGETADIYTPLSLMYDLDK
NDLRGLLGVREHNPMYLMPFWYNNSPNYAPSSPTRGTTVQEKFGQQKRAETKLQVSFKSK
IAENLFKTRADLWFGYTQRSDWQIYNQGRKSAPFRNTDYKPEIFLTQPVKADLPFGGRLR
MLGAGFVHQSNGQSRPESRSWNRIYAMAGMEWGKLTVIPRVWVRAFDQSGDKNDNPDIAD
YMGYGDVKLQYRLNDRQNVYSVLRYNPKTGYGAIEAAYTFPIKGKLKGVVRGFHGYGESL
IDYNHKQNGIGIGLMFNDWDGI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgccgacaatgggggcggagatgaatacacgaaatatgcgctatattcttttgacagga
ctgttgccgacggcatccgcttttggagagaccgcgctgcaatgcgccgctttgacggac
aatgttacgcgtttggcgtgttacgacaggatttttgcggcacagcttccgtcttcggca
gggcaggaagggcaggagtcgaaagccgtactcaatctgacggaaaccgtccgcagcagc
ttggataagggcgaggcggtcattgttgttgaaaaaggcggggatgcgcttcctgccgac
agtgcgggcgaaaccgccgatatctatacgcctttgagcctgatgtacgacttggacaaa
aacgatttgcgcgggctgttgggcgtacgcgaacacaatccgatgtaccttatgccgttt
tggtataacaattcgcccaactatgccccgagttcgccgacgcgcggtacgactgtacag
gaaaaattcggacagcagaaacgtgcggaaaccaaattgcaggtttcgttcaaaagcaaa
attgccgaaaatttgtttaaaacccgcgcggatctgtggttcggctacacccaaagatcc
gattggcagatttacaaccaaggcaggaaatccgcgccgttccgcaatacggattacaaa
cctgaaattttcctgacccagcctgtgaaggcggatttgccgttcggcggcaggctgcgt
atgctcggtgcgggttttgtccaccagtccaacggacagagccgtcccgaatcgcgttcg
tggaacaggatttatgccatggcaggcatggaatggggcaaattgacggtgattccgcgc
gtgtgggtgcgtgcgttcgatcagagcggcgataaaaacgacaatcccgatattgccgac
tatatggggtatggcgacgtgaagctgcagtaccgcctgaacgacaggcagaatgtgtat
tccgtattgcgctacaaccccaaaacgggctacggcgcgattgaagccgcctacacgttt
ccgattaagggcaaactcaaaggcgtggtacgcggattccacggttacggcgagagcctg
atcgactacaaccacaagcagaacggtatcggtatcgggttgatgttcaacgactgggac
ggcatctga

DBGET integrated database retrieval system