KEGG   Neisseria gonorrhoeae FA 1090: NGO1694Help
Entry
NGO1694           CDS       T00237                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NGO1694
   00670 One carbon pool by folate
    NGO1694
Enzymes [BR:ngo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     NGO1694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1645677..1646165)
Genome map
AA seq 162 aa AA seqDB search
MLKITIIAACAENLCIGAGNAMPWHIPEDFAFFKAYTLGKPVIMGRKTWESLPVKPLPGR
RNIVISRQADYCAAGAETVASLEVALALCAGAEEAVIMGGAQIYGQAMPLATDLRITEVD
LSVEGDAFFPEIDRTHWREAERTERRVSSKGVAYTFVHYLKG
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaataaccataattgcggcgtgtgcggaaaacctgtgcatcggggcgggcaat
gctatgccttggcacatccccgaagatttcgcatttttcaaagcctataccttgggcaaa
cccgtcattatggggcggaaaacgtgggaatccctgcccgtcaaacccctgcccggacgg
aggaacatcgtcatcagccggcaggcggattattgcgcggcaggcgcggaaacggtggca
agtttggaggtggcattggcattgtgcgccggcgcggaagaagccgtcattatgggcggc
gcgcagatatacggacaagcgatgccattagcgaccgatttgcggataaccgaagtggat
ttgtctgtggaaggagatgcatttttcccagaaatagaccggacgcattggagagaagca
gagcggacggaacgccgtgtcagcagcaaaggcgttgcatatacattcgtgcattacctc
aagggataa

DBGET integrated database retrieval system