KEGG   Neisseria gonorrhoeae FA 1090: NGO1730Help
Entry
NGO1730           CDS       T00237                                 

Gene name
ruvA
Definition
(RefSeq) Holliday junction ATP-dependent DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
ngo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ngo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NGO1730 (ruvA)
Enzymes [BR:ngo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     NGO1730 (ruvA)
DNA repair and recombination proteins [BR:ngo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     NGO1730 (ruvA)
    RecFOR pathway proteins
     NGO1730 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH HHH_8 Transposase_20
Motif
Other DBs
NCBI-GeneID: 3281203
NCBI-ProteinID: YP_208763
UniProt: Q5F636
Position
1690144..1690728
Genome map
AA seq 194 aa AA seqDB search
MISRLTGKLVEKNPPQIVIDVNGVGYEADVSMQTFYNLPPVGESVQLFTQLIIREDAHLL
FGFATAEERKTFRQLIKVGGIGAKTALGILSAMTADELARAVAEEDVKRLSSAPGIGKKT
AERMVLELRGKLVAHTVTDGLFAASPAADETEDIVSTLLALGYNEREAKAAVKGVPKGTD
VGEGVRLALKNLLK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcagactgaccggcaaactggttgaaaaaaaccctccgcaaatcgtcatcgat
gtcaacggtgtcggttatgaagccgacgtatcgatgcagaccttctacaacctgccgccc
gtgggtgaaagcgtacaactgtttacccagcttatcattcgggaagacgcacatctttta
tttggttttgccactgcggaagaacgcaagaccttccgccaactgattaaggtcggcggc
atcggcgcgaaaacggctttgggcattttgtcggcgatgacggcagacgagctggcgcgg
gcggttgcagaagaagatgtcaaacgcctctcctccgctccgggaatcggcaaaaaaacc
gccgaacgtatggtcttggaactgcgcggcaagctggtcgcgcatacggtaacggacggg
ctgtttgccgcctcacccgccgccgacgaaacggaagacatcgtcagcacgctgcttgcg
ctgggttacaacgaacgcgaggcaaaagcggcggtcaaaggcgttccgaaggggacggac
gtgggcgaaggcgtgcgccttgccctgaaaaacctgctgaaataa

DBGET integrated database retrieval system