KEGG   Neisseria gonorrhoeae FA 1090: NGO1730Help
Entry
NGO1730           CDS       T00237                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ngo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NGO1730 (ruvA)
Enzymes [BR:ngo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     NGO1730 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1690144..1690728
Genome map
AA seq 194 aa AA seqDB search
MISRLTGKLVEKNPPQIVIDVNGVGYEADVSMQTFYNLPPVGESVQLFTQLIIREDAHLL
FGFATAEERKTFRQLIKVGGIGAKTALGILSAMTADELARAVAEEDVKRLSSAPGIGKKT
AERMVLELRGKLVAHTVTDGLFAASPAADETEDIVSTLLALGYNEREAKAAVKGVPKGTD
VGEGVRLALKNLLK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcagactgaccggcaaactggttgaaaaaaaccctccgcaaatcgtcatcgat
gtcaacggtgtcggttatgaagccgacgtatcgatgcagaccttctacaacctgccgccc
gtgggtgaaagcgtacaactgtttacccagcttatcattcgggaagacgcacatctttta
tttggttttgccactgcggaagaacgcaagaccttccgccaactgattaaggtcggcggc
atcggcgcgaaaacggctttgggcattttgtcggcgatgacggcagacgagctggcgcgg
gcggttgcagaagaagatgtcaaacgcctctcctccgctccgggaatcggcaaaaaaacc
gccgaacgtatggtcttggaactgcgcggcaagctggtcgcgcatacggtaacggacggg
ctgtttgccgcctcacccgccgccgacgaaacggaagacatcgtcagcacgctgcttgcg
ctgggttacaacgaacgcgaggcaaaagcggcggtcaaaggcgttccgaaggggacggac
gtgggcgaaggcgtgcgccttgccctgaaaaacctgctgaaataa

DBGET integrated database retrieval system