KEGG   Neisseria gonorrhoeae FA 1090: NGO1769Help
Entry
NGO1769           CDS       T00237                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1733575..1734738
Genome map
AA seq 387 aa AA seqDB search
MSFKLRYLASVLALSSLLAACGGQEKSAAGDASPASETEAASQVQASEAVPSASSASPED
QDLLKRAQGVFQPLPTVEEMQKIRPFTEEQVKLGHQLWYEPRLSKGNTVSCNSCHNLASA
GVDNMPTSQGHKGQFGGRNSPTALNAALLGSQFWDGRAADVEEQAGGPLVNPVEMANDSQ
EAAAAKIAKVPEYQEMFKKAFPEDGAVSFKNITTALGAFERTLLTPTKWDEYLKGNVNAL
SEQERKGVRAFMDNGCIACHNGVNLGGTTFQKFGLVQGPYWKFIEDPKRDKGRADVTKKT
EDEFFFRVPGLRNVAKTYPYFHNGSVWELDKAVTIMGKAQLGKDIPKEDVDNIVVFLNAL
SGNVSESARTMPELPLTAPMESKPDNK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcaaactccgttacctcgcatcagtattggcattgtcttcactgttggcggca
tgcggcggtcaggaaaagtctgcggcaggcgatgcttctcctgcttccgagaccgaagcg
gcttcccaagtacaggcctcggaagccgttccttccgcttcatcggcctcgcccgaagac
caagaccttttgaaacgcgcgcaaggtgtattccaacctttgccgactgtcgaagaaatg
cagaaaatccgtccgtttaccgaagaacaggtcaaactcggacaccaactctggtatgaa
ccacgcctttccaaaggcaataccgtaagctgcaactcttgccacaaccttgcttccgcc
ggtgtggacaatatgccgaccagtcaggggcacaaagggcagttcggcggacgcaactcg
cctaccgcattgaatgctgcgctgctgggcagccagttttgggacggacgtgccgccgat
gttgaagaacaggctggcgggcctttggtgaatccggtggaaatggcgaatgattcgcaa
gaggcggctgcagccaaaatcgccaaagttcccgaatatcaagaaatgtttaaaaaagct
tttcctgaagacggcgcggtttcgtttaaaaacatcactaccgcattgggtgcgtttgag
cgtaccctgctgacgccgaccaaatgggacgaatacctcaaaggcaacgtcaacgccctg
agcgaacaggaacgaaaaggcgtgcgcgcgttcatggacaacggctgtattgcctgccac
aacggtgtcaaccttggaggcacgaccttccagaaattcggtctggtccaagggccgtat
tggaaattcattgaagatccgaaacgcgacaaaggccgtgctgacgtaaccaaaaaaacc
gaagacgaatttttcttccgtgttccggggttgcgtaacgtggctaaaacttatccgtat
ttccacaacggcagcgtgtgggagctggataaggcagttaccatcatgggtaaggcgcaa
ttgggtaaagacattccgaaagaagatgtggataacatcgtcgtattcctgaatgcactt
tccggcaatgtttccgaatcagcgcgcacgatgccggaactgcccctgaccgcaccgatg
gaatctaagccggacaacaaataa

DBGET integrated database retrieval system