KEGG   Neisseria gonorrhoeae FA 1090: NGO1799Help
Entry
NGO1799           CDS       T00237                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NGO1799
Enzymes [BR:ngo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     NGO1799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1771005..1772189
Genome map
AA seq 394 aa AA seqDB search
MTPQVLTILGSTGSIGESTLDVVSRHPEKFRVFALAGHKQVEKLAAQCQTFRPEYAVVAD
AEHAARLEALLKRDGTATQVLHGAQALVDVASADEVSGVMCAIVGAAGLPSALAAAQKGK
TIYLANKETLVVSGALFMETARANGAAVLPVDSEHNAIFQVLPRDYTDRLNEHGIDSIIL
TASGGPFLTTDLSTFDSITPEQAVKHPNWRMGRKISVDSATMANKGLELIEAHWLFNCPP
DKLEVVIHPQSVIHSMVRYRDGSVLAQLGNPDMRTPIAYCLGLPERIDSGVGKLDFGALS
ALTFQKPDFGRFPCLKFAYETINAGGAAPCVLNAANETAVAAFLDGQIKFTDIAKTVAHC
LAQDFSNGMGDIEGLLAQDARTRAQARAFIGTLR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacaccacaagtcctgaccatattaggcagtaccggcagcataggcgaaagcacgctg
gacgttgtctcccgccatcccgaaaaattccgcgtattcgcgctggcagggcataagcag
gtcgagaaactggcggctcaatgtcaaacgttccgccccgaatatgccgtcgttgccgat
gccgaacacgccgcccggcttgaagccctgttgaaacgcgacggcacggcgactcaggtt
ttacacggcgcgcaggcattggttgacgttgcgtctgccgacgaagtcagcggcgtcatg
tgcgccatcgtcggggcggcggggctgccttccgcgctcgcagcggcgcaaaaaggcaaa
accatttatctggcaaacaaagaaacgctggtggtttccggcgcgttgtttatggaaacc
gcccgcgcaaacggcgcggcagtgttgcccgtcgacagcgaacacaacgccattttccaa
gttttgccgcgcgattacacagaccgtctgaacgaacacggcatcgattcgattatcctg
accgcttccggcggcccgtttttaacaaccgatttaagcacgttcgacagcattacgccc
gagcaggcggtcaaacaccccaattggcgtatggggcgcaaaatctccgtcgattcagcc
actatggcaaacaagggcttggaactgattgaagcgcattggctgttcaactgtccgccc
gacaaactcgaagtcgtcatccatccccaatccgtgatacacagtatggtgcgctaccgc
gacggctccgtgctggcgcaactgggcaatcccgatatgcgaacgcccatcgcctattgt
ttgggcttgcccgagcgcatcgattcgggtgtcggcaaactcgatttcggcgcattgtcc
gcgctgaccttccaaaagcccgacttcggccgcttcccctgcctgaagttcgcctatgaa
accataaacgcaggcggagccgcgccctgcgtattgaacgccgccaacgaaaccgccgtc
gccgcctttttggacggacagattaagtttaccgacattgccaaaaccgtcgcccactgt
cttgcacaagacttttcaaacggcatgggcgatatagaaggactgttggcgcaagatgcc
cggacacgcgcacaagcgcgggcatttatcggcacactgcgctga

DBGET integrated database retrieval system