KEGG   Neisseria gonorrhoeae FA 1090: NGO1877Help
Entry
NGO1877           CDS       T00237                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ngo00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ngo00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1846222..1847142)
Genome map
AA seq 306 aa AA seqDB search
MPNPLYRQHIISISDLSREQLEYLLQTALKLKAHPRGDLLEGKLIGSCFFEPSTRTRLSF
ETAVQRLGGKVIGFSDGANTSAKKGETLADTARIISGYTDAIVQRHPKDGAARVAAEFSR
VPVINAGDGTNQHPSQTLLDLVTIYETQGRLDKLKIAMAGDLKYGRTVHSLCQALKRWGC
EFAFVSPPSLAMPDYITEELEEADCRYRALGSLEEAAEWADILYMTRVQRERFDEQEFAK
IQGKFNLEASMLARAKPNLRVLHPLPRTDEIHPDVDAAPHAYYFEQATNGVYARMAILSL
VLNEEV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatccgctttacagacagcacatcatctccatttcggatttgtcgcgcgaacag
ttggaatacctgcttcagacggcattgaagctgaaggcgcatccgcgcggcgatttgttg
gaaggcaaactcatcggttcgtgctttttcgagccgtccacgcgcacgaggctgtcgttt
gaaacggcggtgcagcgtttgggcggtaaggtcatcggcttttcggacggcgcgaatacc
agtgccaaaaaaggcgaaacgcttgccgataccgcccgtatcatttccggctacaccgac
gcgattgtccaacgccatcccaaagacggcgcggcgcgcgtggcggcggagttttcgcgc
gtccccgtcatcaacgccggcgacggcacgaaccaacaccccagccaaaccttgttggac
ctggtaacgatttatgaaacgcaggggcgtttggacaagcttaaaatcgccatggcgggc
gacttgaaatacgggcgcaccgtgcattcgctgtgtcaggcgttgaaacgctggggctgc
gaatttgccttcgtctcgccgcccagcctcgcgatgcccgactacattaccgaagagttg
gaagaagccgactgccgataccgcgccctcggcagtttggaagaggcggcggaatgggcg
gacatcctgtatatgacccgcgtccagcgcgaacgtttcgacgaacaggaatttgccaaa
atccaaggcaaattcaacctcgaagcgtctatgctcgcccgcgccaaaccgaacctgcgc
gtgctgcaccccctgccgcgcacggacgaaatccaccccgatgtcgatgccgcgccgcac
gcctattatttcgagcaggcgaccaacggcgtttatgcgcgtatggcgatattgtcgctg
gtgttgaacgaagaagtgtga

DBGET integrated database retrieval system