KEGG   Neisseria gonorrhoeae FA 1090: NGO1933Help
Entry
NGO1933           CDS       T00237                                 

Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NGO1933
Enzymes [BR:ngo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     NGO1933
    3.5.1.-  
     NGO1933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1910547..1911182
Genome map
AA seq 211 aa AA seqDB search
MIVSIDVDAQKTFTPLCPDELPVNEGHLIVEELNAQAALADLRVMTKDAHHMAAKWLVDN
PVDMLKPTGFSDADLTWVAHAMVGTRGYELLDGLPSVKEYDYCVWKGVDPELHPYGACFH
DIEEKLSTGLIEWLRCQNTNMVIVGGLATDYCVKTTVLQLLKGGRWQVIVNEAACRGIAP
DTIEAAWQEMRSSGAIILKNAEKIKKYINNQ
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgattgtttccattgatgttgatgcacaaaaaacgtttacgccactgtgtcctgacgaa
ctgcccgtgaacgaggggcatttgattgtcgaggagttaaatgcccaagccgctttggcg
gatttgcgtgtgatgacgaaagatgcgcatcatatggcggcgaaatggcttgtggataac
cctgttgatatgttgaagccgacaggtttttccgatgcggatttgacttgggtggctcat
gcgatggtcggtacgcgcggctatgaattgttggacggtctgccttccgtcaaggaatac
gattattgcgtttggaaaggtgtcgatcccgaattgcatccttacggcgcgtgttttcac
gatattgaggaaaaactgagcactggattgattgagtggctgcgttgtcaaaatacgaat
atggtcattgtcggcggcttggctacggattattgtgttaaaacaacggttttgcagtta
cttaaaggcggtcgttggcaggttatcgtgaatgaagcggcttgtcggggtattgcgccc
gataccattgaagcagcgtggcaggaaatgcgttcttcgggtgcgataattttgaaaaac
gccgaaaaaattaaaaaatatattaataatcaataa

DBGET integrated database retrieval system