KEGG   Naegleria gruberi: NAEGRDRAFT_1225Help
Entry
NAEGRDRAFT_1225   CDS       T01241                                 

Definition
tentative phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ngr  Naegleria gruberi
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ngr00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ngr04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 436 aa AA seqDB search
FTRYLFSQANSILKPGFKKLHQDMTLPLSHYFISSSHNTYLTGHQLKGESSVEKYRDVLL
TGCRCVELDCWDGKDEPIIFHGHTLVSKIKFRDVVQIIHDYAFKASEYPVILSLEVHCSE
PQQEMMAKIMVQIFGEDLYMPPPEDIVTYPSPHELRRKILLKGKRLCSGTDEDDDEEEDD
EDDEAVSTPSSSKEKPKKEKKKSKVAKGLSDIIALCAVSFHGEFAEPCWKMHSFSEGKLE
KLLKKDPEALVKYNKNHISRTYPRGTRISSSNYNPMLGWATGCQMVALNYQTYDEHMRFN
EVLFEENGKCGYVVKPDFLRLEGIPSPFSAGTSPVLSVVCGEQLPKPGMSDKGEIVDPFV
RLQVLGIPQDEYDEKSESVTDNGFNPVFNKRFAFSITCPELAVIRISVYDKNKTANEFLC
ENYLPVRQLKKGCRSI
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
tttaccagatatttattttcacaagcaaactcaatattgaaaccaggatttaagaaatta
catcaagatatgactctaccactgtctcactactttatttcatcttctcacaatacctac
ctgacaggacatcaattgaaaggagaaagctctgttgaaaagtatagagatgtactgttg
actggctgtcgttgtgtcgaattggattgttgggatggtaaggatgaaccaatcattttc
catggtcacactctcgtctctaaaattaaattcagagatgtagtccaaattattcacgac
tatgccttcaaagcgtcagagtaccctgtaattttatcattggaagttcactgcagtgaa
ccacaacaagaaatgatggccaagattatggtccaaatatttggagaggatttgtacatg
cctccacctgaagatattgtgacatatccatctcctcacgaattgaggagaaagatcctt
ctcaaaggtaagagattgtgcagtggaactgatgaagatgacgatgaggaggaagacgat
gaggatgacgaagctgtctctactccatcctcctcgaaggagaaaccaaagaaggaaaag
aaaaagtccaaagttgccaaaggtctctcagatataattgcattgtgtgcagtttcattc
catggagagtttgctgagccatgttggaaaatgcacagcttctctgaaggtaaattggaa
aagctcctaaagaaggatccagaagcccttgtcaagtataataagaatcacatctctaga
acctatccaagaggtaccagaatttcatcaagtaattacaatccaatgttgggctgggcc
actggttgtcaaatggttgctctcaattatcagacctatgatgaacatatgagatttaac
gaagttttattcgaggagaatggaaaatgtggctatgttgtaaaacctgactttttacgt
ttagagggcattccaagtccattctctgctggaacttcaccagtattatctgttgtttgt
ggagaacaattgccaaaaccaggtatgagtgataagggagaaattgttgatccatttgtc
agacttcaagtattaggtattccacaagatgaatatgatgaaaagtcagaaagtgtaact
gacaatggtttcaatccagtttttaacaagagatttgcctttagcattacctgtccagag
ttggctgtaattcgtatttcagtttatgacaagaacaagactgcgaatgaatttttatgt
gaaaattatcttccagttcgtcaattaaagaaaggttgcagaagtatt

DBGET integrated database retrieval system