KEGG   Naegleria gruberi: NAEGRDRAFT_1263Help
Entry
NAEGRDRAFT_1263   CDS       T01241                                 

Definition
hypothetical protein
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ngr  Naegleria gruberi
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NAEGRDRAFT_1263
   00330 Arginine and proline metabolism
    NAEGRDRAFT_1263
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    NAEGRDRAFT_1263
Enzymes [BR:ngr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     NAEGRDRAFT_1263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 342 aa AA seqDB search
VVIDFDAFYNIVGENTNIISRALTGRLAIPDWSNFCSKIKEIFEQTKEIKGGNVATYIPQ
LAEVDPELYGLAICTVDGQRFSLGDSDVDFTIQSCSKVFTYCIVCEDIGADNVHQYVGFE
PSGGSFNAFTLDDENKPHNPMINAGAITVCSLVKPDLSPSKRFTYVSSKFSKFAGGSKIG
FDNATFLSEKSTGDRNFALAYYMQENNVFPEESRLEDTLDLYFQICSILVNSNSLATMSA
TLANGGTCPLTNNRIVSNDTVKCALQLMLSCGMYDFSGNWSCTVGLPAKSGVAGAICIVI
PSVMGMCLFSPRLDPRGNSVRGVEFCKRASDLFEWSLFDRLV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gttgtaattgattttgatgctttttataatattgtcggagaaaatacaaatattatcagt
agggcattaactggaagattggcaattccagattggtctaacttttgttctaaaattaaa
gaaatattcgaacaaacaaaggaaatcaaaggtggtaatgtggctacatatatccctcaa
ttagctgaagtggatccagaattatatggattggctatttgtacagtagatggtcaacgt
ttttcattgggggatagtgatgttgattttactattcagtcttgctcaaaagttttcacc
tactgtattgtttgtgaagatattggagcagacaatgttcatcaatatgttggatttgaa
ccaagtggtggaagtttcaatgctttcacacttgatgatgaaaataagccacacaatcca
atgattaatgcaggagctattactgtatgttcactcgtaaaaccagacttgtcaccatca
aagagatttacatatgtttccagtaaattttccaaatttgctggtggcagtaaaattggt
tttgataatgctacctttctaagtgagaaatcaacaggagatcgtaattttgctcttgct
tattatatgcaggaaaataatgtatttccagaagaatctagattggaagacacactagat
ttatattttcaaatttgttccattcttgtcaattctaacagtttagctacaatgtctgca
acattggcaaacggtggaacttgccctctaacaaataatagaattgtatcaaatgacacg
gtaaaatgtgcacttcagttaatgctgtcttgtggaatgtatgatttttctggtaattgg
tcctgcacagttgggttgccagccaagtctggtgttgcaggggcaatatgcattgttatt
ccttctgttatgggaatgtgcttgttttctcctcgtctagatccaagaggaaacagtgtt
agaggtgtagagttctgtaaaagggcatctgatttatttgaatggtctttatttgatcgt
ttggtg

  All links  
No link information was found.   
DBGET integrated database retrieval system