KEGG   Naegleria gruberi: NAEGRDRAFT_2273Help
Entry
NAEGRDRAFT_2273   CDS       T01241                                 

Definition
enoyl-CoA hydratase family member
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ngr  Naegleria gruberi
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NAEGRDRAFT_2273
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NAEGRDRAFT_2273
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NAEGRDRAFT_2273
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NAEGRDRAFT_2273
Enzymes [BR:ngr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     NAEGRDRAFT_2273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 336 aa AA seqDB search
VTLNRPKALNSLNLEMVREMTPKYEELLKSETKMIILKGSGDKAFCAGGDIKAIYESKDP
KFFAEEYQLNYLIGSLYEKHKKVQVALLNGITMGGGVGVSVQPDTLRIATEKTMFAMPET
AIGFFCDVGGSYFLPRIPIKGLGMYLALTGSRLKGEQCVVAGVATHFVPSEKLGELEELL
VKIARESTGPIDKEFIAKEIEKHFPQHQYIHSKHANSFMEHEKEISLFDPSQSPSVHDIV
EGLKKLDTAHAHHTLKTLEQMSPTSLRVVHRQLRMGSVLGYKECFDMEYGMAKQMMNGND
FFEGVRALLVDKDKNPKWNPATLDQVKQKDVDMYFE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gttactctcaacagaccaaaggctttaaattcactcaacttggaaatggttagagaaatg
acaccaaaatatgaagaattattaaaatcagaaactaaaatgattattttaaagggttct
ggtgataaagctttctgtgctggtggtgatattaaagcaatttatgaatcaaaagatcca
aaattctttgctgaagaatatcaattgaattacttgattggttctctctatgaaaaacat
aagaaggttcaagtagcattgttaaatggtattactatgggaggtggtgttggagtgagt
gttcaaccagatactttgagaattgcaactgaaaagacaatgtttgccatgccagaaaca
gctattggtttcttttgtgatgttggtggaagttatttcttaccaagaattccaattaag
ggacttggtatgtatttggcattgacaggttcaagattgaagggggaacaatgtgttgtt
gctggtgttgctactcattttgttccaagtgaaaaattgggtgaattggaagaattactt
gtaaagattgctcgtgaaagtactggaccaattgataaggaattcattgccaaggaaatt
gaaaagcatttcccacaacatcaatatattcattccaagcatgctaattcattcatggaa
catgaaaaggaaatttcattgtttgatccatctcaaagtccttcagttcatgatatcgtt
gaaggattgaagaaattggatactgctcatgcccatcatactctcaagactttggaacaa
atgtcaccaactagtttgagagttgttcacagacaattgagaatgggaagtgttttagga
tataaggaatgttttgatatggaatatggaatggctaaacaaatgatgaatggtaatgat
ttctttgaaggtgttagagctttacttgttgataaggataagaatccaaagtggaatcct
gctactcttgatcaagttaaacaaaaggatgtagacatgtattttgaa

DBGET integrated database retrieval system