KEGG   Naegleria gruberi: NAEGRDRAFT_2439Help
Entry
NAEGRDRAFT_2439   CDS       T01241                                 

Definition
hypothetical protein
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
ngr  Naegleria gruberi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 320 aa AA seqDB search
GLKNIGNTCFMNSTLQCLCSIQPIRDYFLSQFKINPKKEGNLATQFSALLRSLTSVDDLY
TPVNPIDFKRTLNQYTSLFRGNDQQDSQEFLRYVLDGLSEDTNRIVEKPKYEELEDIANE
NIIDQSNRWFRNYIERSSSFVTDLFLGQLKSEIKCLVCGRQSVTFDPFLDICLPINLKRG
RKSYISYDRDVSLEECLLKFTEEECLGGIEQVYCSSCKKHQDTSKVLSFFRVPEVLVIQL
KRFSNDQKLLDQVNLCELLEFNNYVAPEAADKIYNNQPITYQLMGVIKHFGSLRGGHYIC
QVRNAEGQWIEYNDSAVKNV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ggactgaaaaatattggaaacacttgtttcatgaactcaaccttacaatgtctgtgctca
attcagccaataagagattattttttatctcaattcaaaattaatccaaagaaggaaggt
aatttggctacacagttttctgcccttcttcgttctctaacctcagtagatgatctttac
acccctgtcaatccaattgatttcaaaagaactcttaatcaatacacttcccttttcaga
ggaaatgatcaacaagactctcaagagtttttaagatatgtactagatggattgagtgaa
gatacaaacagaattgttgaaaaaccaaaatatgaagagcttgaagatatagcaaacgag
aacattattgaccagtctaacagatggtttcgaaattacattgagagaagcagtagtttt
gttactgatttatttcttggacaactcaaatctgaaattaagtgtttggtgtgtggaagg
caatcagtaacgtttgatccattccttgatatttgccttcccatcaatttgaaaagaggg
agaaagtcctatatttcatatgacagagatgtttcattggaggagtgtttgttaaagttt
acggaagaagagtgtttgggcggaattgaacaagtttactgtagttcgtgtaaaaaacat
caggacacttccaaagtattgtctttctttagagttcctgaagtcttagtaatacaattg
aaacgattttccaatgaccaaaagttgttggatcaagttaatctttgtgaattattagaa
ttcaataattacgtagcaccagaagctgccgataagatttacaacaatcaaccaataaca
tatcaactaatgggagtgattaaacattttggaagtttacgaggagggcactacatttgc
caagtgaggaatgcagaaggacaatggatagaatataacgatagtgctgtaaagaatgta

DBGET integrated database retrieval system