KEGG   Naegleria gruberi: NAEGRDRAFT_29287Help
Entry
NAEGRDRAFT_29287  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ngr  Naegleria gruberi
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NAEGRDRAFT_29287
   01230 Biosynthesis of amino acids
    NAEGRDRAFT_29287
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAEGRDRAFT_29287
   00051 Fructose and mannose metabolism
    NAEGRDRAFT_29287
   00562 Inositol phosphate metabolism
    NAEGRDRAFT_29287
Enzymes [BR:ngr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NAEGRDRAFT_29287
Exosome [BR:ngr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NAEGRDRAFT_29287
  Exosomal proteins of bladder cancer cells
   NAEGRDRAFT_29287
  Exosomal proteins of melanoma cells
   NAEGRDRAFT_29287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 252 aa AA seqDB search
MRTPYIGGNWKCNGTVESIKQLVQDLNQGPSTEGKVEVIVAPSSIHIGLVQSLNLRKDWK
ISAQNIVQEKNGGAFTGEISASMLKDLGIDSTLLGHSERRHVFGESNTVIAKKVKVSEEV
GLTIIGCVGETLEERERGETNQVITSQLKDFNVTNWDKFVIAYEPVWAIGTGKTASPQQA
QEAHKVLRDWLADNVNSEVAQKVRIIYGGSVNSANSDELIKQPDIDGFLVGGASLKSKDF
LSIVNSGLKSVE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacaccatacattggaggaaactggaagtgcaacggaactgttgaatcaatcaaa
caacttgtccaagatttaaatcaaggaccttcaactgaaggaaaagttgaagttattgtt
gctccatcatctatccacattggtcttgttcaatcacttaacttgagaaaagattggaag
atcagtgctcaaaatattgttcaagaaaagaacggtggagcctttactggtgaaatcagt
gcttcaatgttgaaggatttaggtatcgatagtactcttcttggtcatagtgaacgtcga
catgtttttggtgagtcaaacactgttattgccaagaaggtaaaggtttcagaggaagtt
ggcttgacaattattggatgtgttggtgaaactttagaagaaagggaaagaggagaaacc
aatcaagtcattacctcacaattgaaggatttcaatgttactaattgggacaagtttgtt
attgcttatgaacctgtatgggccatcggaactggtaaaacagcctctcctcaacaagca
caagaagctcacaaggttttgagagattggttggctgataatgtaaattccgaagttgct
caaaaagtcagaattatctatggtggtagtgtaaatagtgccaactctgatgaacttatt
aagcaaccagatattgatggattccttgttggtggtgcatccctcaagagcaaggacttc
ttgtcaattgttaattctggtttgaaaagtgtcgaatga

DBGET integrated database retrieval system