KEGG   Naegleria gruberi: NAEGRDRAFT_29590Help
Entry
NAEGRDRAFT_29590  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
ngr  Naegleria gruberi
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ngr00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ngr04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 519 aa AA seqDB search
MEYLEQVLSESPLKLPTDEEKWRLWEAREILKKNPKALPKVMLSVPWQYPYAVYLAHSII
PKWKEPETLDAIELLDFNYSSEHVRRYALKLLDKLPDNTFADFVLQLVQTLKYELYHDSP
LSRYLLKRGLRSTHIIGHILFWHLKAEMHVPYIRERYGIILEEYLRNCGGHRRELLKQSG
IVGQLYSIAMKVKEAKSEDHLKVLREELSKLRHPPKFTLPLSPKMEVKGVLVDKCKVMDS
KKLPLWLVFENADETAAPVFVMFKAGDDIRQDLLTLQMLKIMDKLWKHEGLDLHMQPYGC
VCLGDMIGMIEIVLNSTTIAKITGKALHAFSDEPIYNWLKLHNTTDNEWITAVNNFALSS
AGYCVATYVLGIGDRHNDNIMVTKKGDLFHIDFGHFLGNYKSFLLYKRETAPFVFTTMYA
YVMGGEGSTKYIEFSENCCAAYNIIRQHGKLLINLFLLMLATGIPELRSSNDVKWIENCL
KLKGTDEEGSAHFREQLKKSLSNTKTNINNALHIIAHQK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggagtatttagaacaagttttatcggagagtccccttaaacttccaacagatgaagaa
aaatggagattgtgggaagccagagagattttgaaaaaaaatccaaaagccctaccaaaa
gtaatgttgagtgttccttggcaatacccatatgctgtctatctggcccattcaataata
cctaaatggaaagagccagaaaccttggatgcaatcgagttgcttgattttaattacagt
agcgaacatgtgagaagatatgcattgaaattgttggataagctaccagataatacgttt
gctgattttgtattacaattagtacaaactctcaagtatgaattatatcacgattctcca
ctctctaggtatttgctaaagagaggcttgagaagcactcacattattggacatatttta
ttttggcacttgaaggcagaaatgcacgtgccttacattagagaacgatatggtataata
ttggaagaatatttgagaaattgtggaggtcacagaagagagctattgaaacaaagtggt
attgtaggtcaattgtactcaattgcaatgaaagttaaggaggccaaatctgaagaccat
ttgaaggtactaagagaagagctatccaagctaagacatcctccaaaatttactcttcca
ctcagtccaaagatggaagtcaaaggtgtattggttgataagtgtaaggttatggattcc
aaaaagttaccgctttggcttgtttttgaaaatgctgatgaaacagcagctcctgtattt
gtaatgttcaaagctggtgatgatatcagacaagatttgcttacacttcaaatgctcaag
attatggacaagttgtggaaacatgaaggcctcgatctacacatgcaaccatatggttgt
gtatgtttgggtgatatgattggtatgattgagattgttctcaacagtactaccattgca
aagattactggtaaagctttgcatgccttctctgatgaaccaatatacaattggctaaag
ttgcacaacacaacagataatgaatggattacagctgtgaataactttgccctttcaagt
gcaggctattgtgttgcaacgtatgtgcttggtattggtgatagacacaatgataatatc
atggtaacaaagaaaggagacttattccacattgattttggtcactttttgggtaactac
aagagtttcctattatataaaagagaaacagcaccattcgtattcactacaatgtatgcc
tatgtgatgggaggtgaaggaagtacaaagtatattgaattttcagagaattgttgtgcg
gcttacaatattatcagacagcacggaaagttactcattaacttgtttttactaatgctt
gcaacaggtattccagaattgagatcttcaaatgatgtaaaatggattgaaaattgttta
aagttgaaaggaacagacgaagaaggttctgctcactttagagaacaattaaagaagagt
ctcagcaataccaagacaaatatcaacaatgcactccatattattgcccaccaaaagtaa

DBGET integrated database retrieval system