KEGG   Naegleria gruberi: NAEGRDRAFT_30206Help
Entry
NAEGRDRAFT_30206  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ngr  Naegleria gruberi
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ngr00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ngr00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 162 aa AA seqDB search
MTTTDIYSFSVKDADLNEVSLSEYKGKVLLIVNVASKCGFTKQYDDLQEVYNKYKEQGFE
VLAFPCNQFGSQEPGTNEEICTFARSKFKTTFKIFDKVEVNGSGTIPLYAYLKKEGSGFL
VDAVKWNFTKFLVSKSGKVLKRYSPTTNPKDLEDDIQKLLKE
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgactaccactgatatttattcattctctgttaaagatgctgatttgaatgaagtttcc
ctctccgaatataaaggaaaggttttactaattgttaatgttgcttccaagtgtggattt
actaaacaatatgatgatttacaagaagtgtacaacaagtataaggagcaaggatttgaa
gttttggctttcccttgcaatcaattcggaagtcaagaaccaggaaccaatgaagaaatt
tgtacatttgccagatctaaattcaagacaactttcaagattttcgataaggttgaagtt
aatggatcaggtaccattccactctatgcttatttgaagaaggaaggttctggtttcctt
gttgatgctgttaaatggaattttactaaattcctcgtttcaaagagtggtaaagttttg
aagagatattctccaacaactaatccaaaggatttggaagatgatattcaaaaattgtta
aaggaataa

DBGET integrated database retrieval system