KEGG   Naegleria gruberi: NAEGRDRAFT_31357Help
Entry
NAEGRDRAFT_31357  CDS       T01241                                 

Definition
(RefSeq) hypothetical protein
  KO
K19584  protein kinase X [EC:2.7.11.11]
Organism
ngr  Naegleria gruberi
Brite
Enzymes [BR:ngr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     NAEGRDRAFT_31357
Protein kinases [BR:ngr01001]
 Serine/threonine kinases: AGC group
  PKA family
   NAEGRDRAFT_31357
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 8849258
NCBI-ProteinID: XP_002680447
JGI: Naegr1_31357
AA seq 331 aa AA seqDB search
MHDSLDPSQWKITDFELLEIIGTGTFGSVRLVKHKHTQQYYAMKIIKKYDVIRMKQVEHI
ISEKNILSQVDHPFIVRLYRTFQDENYLFMIMEYVCGGELFSHLRRVGKFPNDVAKFYAA
EIILAMEYLHMKNIVYRDLKPENVLLDNDGHVKITDFGFAKKVLDRTWTLCGTPEYLAPE
IIQSKGHGKAVDWWALGILIYEMLVGYPPFFDDSPFKIYEKILQGKVEFPRFMDPMARDL
IKRLLTTDKMKRLGNLKGGAADIKEHKWFKGVDWDELYNRQIASPIPVKISFAGDSRYFE
TYPESQDHCIHHTGTPHQQLSADVQALFDGF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcatgactcactcgatccttcccaatggaaaataacagattttgaattgttagaaatt
attggtactggtacttttggtagtgttagattagttaaacataaacatacacaacaatac
tatgctatgaaaattattaaaaagtatgatgtaattagaatgaaacaagtagaacatatc
attagtgagaagaatattctctctcaagttgatcatcctttcattgttagactttataga
acattccaagatgaaaattatttattcatgattatggaatatgtgtgcggaggtgaattg
ttttcacatttgagacgtgttggtaaattccctaatgatgttgcaaagttttatgctgct
gaaattattttagctatggaatatcttcatatgaagaatattgtttatcgtgatttgaaa
ccagaaaatgttttattagataatgatggtcatgtaaaaattactgattttggttttgct
aagaaggttcttgaccgtacgtggactttatgtggtactcctgaatatttagctcctgaa
attattcaatctaagggtcatggtaaagctgttgactggtgggcattaggtattcttatt
tatgaaatgttagttggttatccaccattctttgatgattcacctttcaaaatttatgaa
aagattttacaaggaaaggttgaatttccaagatttatggatccaatggctcgtgattta
attaaacgtctcttaactacagataagatgaaacgtttgggtaatttgaaaggaggtgct
gctgatattaaggaacacaaatggtttaagggtgttgattgggatgaattatataataga
caaattgcatctccaattcctgtcaagattagttttgcaggtgattctagatactttgaa
acttatccggaatctcaagatcattgtattcaccacactggtactccacatcaacaatta
tctgctgatgttcaagctctatttgatggtttttaa

DBGET integrated database retrieval system