KEGG   Naegleria gruberi: NAEGRDRAFT_31357Help
Entry
NAEGRDRAFT_31357  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ngr  Naegleria gruberi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 331 aa AA seqDB search
MHDSLDPSQWKITDFELLEIIGTGTFGSVRLVKHKHTQQYYAMKIIKKYDVIRMKQVEHI
ISEKNILSQVDHPFIVRLYRTFQDENYLFMIMEYVCGGELFSHLRRVGKFPNDVAKFYAA
EIILAMEYLHMKNIVYRDLKPENVLLDNDGHVKITDFGFAKKVLDRTWTLCGTPEYLAPE
IIQSKGHGKAVDWWALGILIYEMLVGYPPFFDDSPFKIYEKILQGKVEFPRFMDPMARDL
IKRLLTTDKMKRLGNLKGGAADIKEHKWFKGVDWDELYNRQIASPIPVKISFAGDSRYFE
TYPESQDHCIHHTGTPHQQLSADVQALFDGF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcatgactcactcgatccttcccaatggaaaataacagattttgaattgttagaaatt
attggtactggtacttttggtagtgttagattagttaaacataaacatacacaacaatac
tatgctatgaaaattattaaaaagtatgatgtaattagaatgaaacaagtagaacatatc
attagtgagaagaatattctctctcaagttgatcatcctttcattgttagactttataga
acattccaagatgaaaattatttattcatgattatggaatatgtgtgcggaggtgaattg
ttttcacatttgagacgtgttggtaaattccctaatgatgttgcaaagttttatgctgct
gaaattattttagctatggaatatcttcatatgaagaatattgtttatcgtgatttgaaa
ccagaaaatgttttattagataatgatggtcatgtaaaaattactgattttggttttgct
aagaaggttcttgaccgtacgtggactttatgtggtactcctgaatatttagctcctgaa
attattcaatctaagggtcatggtaaagctgttgactggtgggcattaggtattcttatt
tatgaaatgttagttggttatccaccattctttgatgattcacctttcaaaatttatgaa
aagattttacaaggaaaggttgaatttccaagatttatggatccaatggctcgtgattta
attaaacgtctcttaactacagataagatgaaacgtttgggtaatttgaaaggaggtgct
gctgatattaaggaacacaaatggtttaagggtgttgattgggatgaattatataataga
caaattgcatctccaattcctgtcaagattagttttgcaggtgattctagatactttgaa
acttatccggaatctcaagatcattgtattcaccacactggtactccacatcaacaatta
tctgctgatgttcaagctctatttgatggtttttaa

DBGET integrated database retrieval system