KEGG   Naegleria gruberi: NAEGRDRAFT_31364Help
Entry
NAEGRDRAFT_31364  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K18670  
dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
ngr  Naegleria gruberi
Brite
Enzymes [BR:ngr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     NAEGRDRAFT_31364
Protein kinases [BR:ngr01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   NAEGRDRAFT_31364
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 418 aa AA seqDB search
MTIGLALHKDFNRKQPLTDPSIGVHNGGLDNADGNLIIYAGSILGERYYVKEMLGQGTFG
QVVKCEDLTSKQIVAVKVVKNKPSYLRQARIEIAILDELAKYGSNGSHHIITKLGEFNHQ
NHLCIVIEILGMNLFELIKQNRFKGLSLNVLSVFLSQLLDALCILSEANIIHCDLKPENI
LLTDLSHPKDLVRLIDFGSACHENEIGPFYIQSRFYRAPEVIFGLRYNKAIDMWSLGCIC
AELFLGLPLLPGVSQYNQVGRMIEMFGIPPPYMIEYGKYSAKYFKILPPNRMNPNDPDLP
LHQDGTPSMYELKTERQFLAENPNQAPMEWKRYFNYTKLPDLVKHYGDISKVDEKEMRTR
ASFIDFLNGLLQLDPYKRWTPDQAKLHPFVTGKDFVEPFIPPQTSQYLAHIQNLQQLH
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaccattggtcttgctcttcacaaagactttaacagaaagcaaccattgacagatcct
tcaataggggttcataatggcggacttgataatgcagatggcaatttgatcatttatgct
ggttcaatacttggagaacgttactacgttaaggaaatgcttgggcaaggtacttttgga
caagttgtcaaatgtgaggacttgacatcaaagcaaattgttgctgtcaaagtggtaaag
aacaaaccatcttatttgagacaagcacgtattgaaattgctattcttgatgagctggca
aagtatggctccaatgggtctcatcatatcattacaaaattaggagaattcaatcaccaa
aaccatctatgtattgtgattgaaatattaggaatgaatcttttcgagttaatcaaacaa
aacagattcaaaggcctttctttgaatgttttatcggtctttttatcacaattactggat
gctttatgcatcttgtcagaggccaatataatccattgtgatttgaaaccagaaaatatt
ctgctgacagatctttctcatcctaaagatctagtaagattgatagattttggttctgca
tgtcatgaaaatgaaataggaccattttacattcaatcaagattttatagagctccagag
gttattttcggactaagatacaataaggctattgacatgtggtctcttggatgcatttgt
gctgaactatttctaggattaccattacttcctggtgtaagccagtacaatcaagttggt
agaatgattgaaatgtttggtattccaccaccatacatgatcgaatatggaaaatactcg
gccaaatatttcaaaatacttcctcccaatagaatgaatcctaatgatccagatttacca
cttcatcaagatggcactcctagcatgtatgaattgaagactgaaagacaatttttggca
gaaaatcctaatcaagctcctatggaatggaaaagatatttcaactatacaaaacttcct
gatcttgtgaaacattatggagatatttccaaggttgatgagaaggaaatgagaactaga
gcatcttttattgattttcttaatggtttactgcagttggatccttacaagcgatggaca
cctgaccaagctaaattgcatccatttgttacaggaaaagactttgttgaacctttcatt
cctccacaaacatctcaatatttagctcacattcaaaatcttcaacaattgcat

DBGET integrated database retrieval system