KEGG   Naegleria gruberi: NAEGRDRAFT_32141Help
Entry
NAEGRDRAFT_32141  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
ngr  Naegleria gruberi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 365 aa AA seqDB search
MGNTNTAESTQNGPNGSTPLTNSRRIDTKIDEGNEKYFGLENFGNTCYANSVLQALYFCK
PFRNHILNYYKTIPQNSEPNLLVSLADLFYQLNNQKKKTGYLGPKAFIQRLRLDNEMFKS
LMQQDAQEFLNYLLNHFVEILQHELKNQESQTNDNEDLKKLKTFIHDIFEGTLINETRCI
MCENVTSREESFLDLSVDVQQYSSITQCLKNFSGMQILKSNNKFYCDRCCSHQEAQTSMK
IKRQPQVLAIQLKRFKYMNNNFKKLSYRVTFPFDFKLPNLSQDEKVKTYKLFAAVVHIGS
GPNCGHYKCIIRSEERWFLFDDDKVSNVDEDYVKSTFGFPHDEASSFSGISETCYILFYS
SIGDE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgggaaataccaatactgcagaatcgacacaaaacggtccgaatggatctacaccattg
acgaattctcgtagaatagacacaaaaattgatgaaggaaatgaaaagtattttggattg
gagaatttcggaaatacatgttatgctaatagtgttctgcaggcattgtatttttgcaaa
ccatttagaaatcacatcttgaattactataaaacaataccacaaaattcggaacctaat
ttactagtatcattggctgatctgttttatcagttaaataatcaaaagaaaaagactgga
tatttgggaccaaaagcattcatacaaagattgagactggataatgaaatgtttaaatct
ctaatgcaacaagatgcacaagaatttctcaattatttactaaatcactttgtggaaatt
ttacaacatgaactgaaaaatcaagaatcacaaacaaatgataatgaggatctaaaaaaa
ctgaaaacatttattcatgacatatttgaaggaactttgataaatgaaacgagatgtatc
atgtgtgagaatgtaactagtagggaagaatcgtttctagatctcagtgtagatgttcaa
caatattcctcaattactcaatgtttaaaaaactttagtggaatgcaaattttaaaatcc
aataacaaattttactgtgatcgttgctgttcacaccaggaagcccaaacaagtatgaaa
atcaaaagacaaccccaagtacttgcaatccaattgaagagattcaaatatatgaataat
aactttaaaaagttatcatatcgagtaaccttcccattcgattttaaattgccaaacctg
tcgcaagatgagaaagtgaaaacttacaaattatttgcagcagttgttcacattggctca
ggaccaaattgtggccattacaagtgtataattagatctgaagagaggtggttccttttt
gatgatgataaagtgtccaatgtggatgaagattatgtaaaatccacatttggcttccct
cacgatgaggcatcctcattttctggtatttcagaaacatgctacattttattctattcc
agtattggtgatgaataa

DBGET integrated database retrieval system