KEGG   Naegleria gruberi: NAEGRDRAFT_32547Help
Entry
NAEGRDRAFT_32547  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ngr  Naegleria gruberi
Brite
Enzymes [BR:ngr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     NAEGRDRAFT_32547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 234 aa AA seqDB search
MAWRCSGQSNAELIANLFKSNIISSNSVSRAMSRTDRALFCRSDHRDYAYLDQPLPIGND
VTISAPHMHAYCLELLEDHLKPGNRAMDVGSGSGYLVATMAEMMAPQVEHVVEGTKIVGI
EYLQSIYLFGKENIEKYQKTKDLMNQGIIEMIKGDGWKGYAQGGPYHAIHVGAAASTLPH
ALVEQLANGGRLIIPVGDIDQHLMVIDKDINGKVTQKKVMGVRYVPLVNPTNCK
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcctggagatgttctggacaaagtaatgccgaactgattgccaatctgtttaaatcc
aatatcatttcaagtaatagtgtctcgagggcaatgtctcgtaccgatcgtgcactgttt
tgcaggagtgatcatcgagattatgcctacttggatcaacctcttccgatcggaaatgat
gtgacaatatctgctcctcatatgcatgcctattgtttggaattgttggaagatcatttg
aaaccaggaaatagagcaatggatgttggaagtggtagtggctatcttgttgctactatg
gctgaaatgatggctccacaagttgaacatgtggttgaaggaactaaaattgttggcatt
gaatatttgcaatcaatctatttatttggaaaggaaaatattgaaaagtatcaaaaaaca
aaggatttaatgaatcaaggtattattgaaatgattaaaggagatggatggaaaggctat
gctcaaggaggtccatatcatgctattcatgttggagcagctgcatccacacttcctcat
gcacttgttgagcaattggcaaatggtggcagattgatcattcctgttggtgatatagat
caacacttgatggtaattgataaggatatcaatggcaaagtcacccaaaagaaagtaatg
ggagtgagatatgttcctcttgtcaacccaacaaattgtaaataa

DBGET integrated database retrieval system