KEGG   Naegleria gruberi: NAEGRDRAFT_33447Help
Entry
NAEGRDRAFT_33447  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K08850  
aurora kinase, other [EC:2.7.11.1]
Organism
ngr  Naegleria gruberi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 290 aa AA seqDB search
MKTTESTTEQTQSTTTQESSTGAKKSTWKLQDFEIGNYLGKGKFGQVYLAREKRTKYIVA
LKVLDKEQLKREGVEHQIRREIEIQSHLRHKNILRLYGYFYDRQKVYLILEYAAGGELYK
QLQECKRFSEPEAARYITGLAKALKYCHDRNVIHRDIKPENLLMDSNHDVKIADFGWSVH
APTTRRTTLCGTLDYLPPEMVEGREHDSTVDLWCLGVLCYEFLVGEPPFMAPTQEETFKK
IKDVDLRFPPFVSIDAQDLISRLLVKDTLQRMSLTELFEHPWIVNNCPAQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaagactacagagtcaaccactgaacaaactcaatctactacaacacaggaatcatca
actggggctaagaaatctacatggaaactccaagattttgaaattggaaactatcttgga
aagggtaaatttggacaagtataccttgcaagagaaaagagaacaaaatatattgtagca
ttaaaggttctagataaagaacaattaaagagagaaggtgtagaacatcaaatcagaaga
gaaattgaaattcaatcccatctcagacacaagaacattttgagattatatggctatttc
tatgataggcaaaaggtatatttgattttggaatacgcagctggaggtgaattatacaaa
caattacaagaatgtaaacgtttttctgaaccagaagcagctagatacattacaggactt
gccaaagctctcaaatattgtcatgacagaaatgtcattcaccgtgatatcaaacctgag
aatttattgatggactcaaatcatgatgtaaaaattgctgattttggttggagtgttcat
gcaccaaccacaagaagaacaacactttgtggaactttggattatttacctcctgaaatg
gttgaaggaagagaacatgattcaacagttgacttgtggtgtttgggagtattgtgttat
gaattcttagttggtgaaccaccattcatggctccaacacaagaagaaacatttaagaaa
attaaggatgttgatttacgattcccacctttcgtttctattgatgctcaagatttaatc
agtagattacttgtcaaggatactttgcaaagaatgtcattgacagaattatttgaacat
ccgtggattgttaataattgccccgcccaataa

DBGET integrated database retrieval system