KEGG   Naegleria gruberi: NAEGRDRAFT_33859Help
Entry
NAEGRDRAFT_33859  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
ngr  Naegleria gruberi
Pathway
Regulation of autophagy
Class
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:ngr04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 336 aa AA seqDB search
MSVIRIGNYRLGKTLGEGSFGKVKLAEHESTGHKVAVKILNRQKIQSSKMDKKIRREIKI
LKLFRHPHIIRLYEVIETSTEIFLVMEHVGGGELFDYIVKRGRLSESEARKFFQQIISGV
EYCHRYMVVHRDLKPENLLLDNDFQVKIADFGLSNIMHDGAFLKTSCGSPNYAAPEVITG
KLYAGPEVDVWSCGVILYALLCGKLPFDEDNIPTLFKKIKECSYTIPSHVSQEAKDLIQK
ILVVDPVQRATISDIRKHPWFVKDLPDYLKIPPSNFGHASENINIDEGVVHEALLKISDK
KTITEEEMEEAINDISDGKMNRVTVAYYLILDHKMK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttattcgtattggtaactatcgattgggtaagacactgggagaaggttctttc
ggtaaagtaaaattggccgaacatgaaagcactggacacaaagtggcagtcaaaattctc
aacagacagaaaattcaaagttcaaagatggataagaagattagaagagaaatcaaaatt
ttgaaattgttcagacacccacacattattcgtctttatgaagtcattgaaacaagcact
gaaatctttctagtaatggaacacgtcggaggtggtgaattgtttgattatattgtaaag
agaggaagattatctgaatcggaagctagaaagttcttccaacaaattatttctggtgtt
gaatattgccatcgttatatggttgttcacagagatttgaaacctgaaaatcttttactt
gacaatgatttccaagtcaaaattgctgactttggtttgagtaatattatgcatgatggt
gcttttttaaagacatcttgcggatctccaaactatgctgctccagaagttattactggt
aaattatatgctggaccagaagttgatgtttggagttgtggtgtaattttatatgctctc
ctctgtggtaaattgccatttgatgaagataatattccaactctcttcaaaaagattaag
gaatgttcttataccattccttcacatgtatctcaagaagctaaggatttaattcaaaag
attttggttgttgatcctgttcaacgtgccacaatttccgatatcagaaagcatccgtgg
tttgtaaaggatctccctgattatttgaaaattccaccatccaactttggtcacgctagt
gaaaatatcaatattgatgaaggtgttgttcatgaagcccttcttaaaatttctgataag
aaaaccattactgaagaagaaatggaagaagctattaatgatatctctgatggtaaaatg
aatcgtgtaactgtagcatattatttaattcttgaccataagatgaag

DBGET integrated database retrieval system