KEGG   Naegleria gruberi: NAEGRDRAFT_33859Help
Entry
NAEGRDRAFT_33859  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
ngr  Naegleria gruberi
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    NAEGRDRAFT_33859
Enzymes [BR:ngr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     NAEGRDRAFT_33859
Protein kinases [BR:ngr01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   NAEGRDRAFT_33859
Mitochondrial biogenesis [BR:ngr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    NAEGRDRAFT_33859
  Mitophagy factors
   Other mitophagy factors
    NAEGRDRAFT_33859
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 336 aa AA seqDB search
MSVIRIGNYRLGKTLGEGSFGKVKLAEHESTGHKVAVKILNRQKIQSSKMDKKIRREIKI
LKLFRHPHIIRLYEVIETSTEIFLVMEHVGGGELFDYIVKRGRLSESEARKFFQQIISGV
EYCHRYMVVHRDLKPENLLLDNDFQVKIADFGLSNIMHDGAFLKTSCGSPNYAAPEVITG
KLYAGPEVDVWSCGVILYALLCGKLPFDEDNIPTLFKKIKECSYTIPSHVSQEAKDLIQK
ILVVDPVQRATISDIRKHPWFVKDLPDYLKIPPSNFGHASENINIDEGVVHEALLKISDK
KTITEEEMEEAINDISDGKMNRVTVAYYLILDHKMK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttattcgtattggtaactatcgattgggtaagacactgggagaaggttctttc
ggtaaagtaaaattggccgaacatgaaagcactggacacaaagtggcagtcaaaattctc
aacagacagaaaattcaaagttcaaagatggataagaagattagaagagaaatcaaaatt
ttgaaattgttcagacacccacacattattcgtctttatgaagtcattgaaacaagcact
gaaatctttctagtaatggaacacgtcggaggtggtgaattgtttgattatattgtaaag
agaggaagattatctgaatcggaagctagaaagttcttccaacaaattatttctggtgtt
gaatattgccatcgttatatggttgttcacagagatttgaaacctgaaaatcttttactt
gacaatgatttccaagtcaaaattgctgactttggtttgagtaatattatgcatgatggt
gcttttttaaagacatcttgcggatctccaaactatgctgctccagaagttattactggt
aaattatatgctggaccagaagttgatgtttggagttgtggtgtaattttatatgctctc
ctctgtggtaaattgccatttgatgaagataatattccaactctcttcaaaaagattaag
gaatgttcttataccattccttcacatgtatctcaagaagctaaggatttaattcaaaag
attttggttgttgatcctgttcaacgtgccacaatttccgatatcagaaagcatccgtgg
tttgtaaaggatctccctgattatttgaaaattccaccatccaactttggtcacgctagt
gaaaatatcaatattgatgaaggtgttgttcatgaagcccttcttaaaatttctgataag
aaaaccattactgaagaagaaatggaagaagctattaatgatatctctgatggtaaaatg
aatcgtgtaactgtagcatattatttaattcttgaccataagatgaag

DBGET integrated database retrieval system