KEGG   Naegleria gruberi: NAEGRDRAFT_33959Help
Entry
NAEGRDRAFT_33959  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K08850  
aurora kinase, other [EC:2.7.11.1]
Organism
ngr  Naegleria gruberi
Brite
Enzymes [BR:ngr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     NAEGRDRAFT_33959
Protein kinases [BR:ngr01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   NAEGRDRAFT_33959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 341 aa AA seqDB search
MNDHNNKENPRSHPNIQHNNGFAVPPKKTNSTLTTTARPSSVNSKATTSKVNNSIVEKVN
NSEDEVVYPDHPRNDWTINDFEIGKPLGTGKFGRVYLAREKKSKFIVALKLLDKKQLEKE
KVAHQLRREIEIQSHLRHKNILRLYGYFYDEKKVYLILEYAPGGEMYHFLQKCTRFSEEQ
TSKFMYQMARALKYCSAKHVIHRDIKPENLLLDGNGELKIADFGWAVHAPTSRRKTLCGT
LDYLPPEMIEKKAHNATVDLWCIGVLCYEFLTGNPPFFAQDDKSTMRNIVAVRYSFPEYV
GDEAKDLVRKLLVKEPSNRITLEQVLKHPFIITYNKNKDEM
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcacaacaacaaggaaaatccacgatcacatcctaatatacagcataataat
ggctttgctgttcctccaaaaaagacaaactctacactcaccacaacagcaagaccatca
tcagttaatagcaaagccacaacctcaaaagtaaataatagtatagtagaaaaggttaac
aactcagaggatgaagttgtttatcctgatcatcctagaaacgattggactattaatgat
tttgaaattggtaaacctttaggtaccggaaagtttggtagagtttatttagccagagag
aagaaatctaaattcattgttgctctcaaattacttgataagaaacaattggagaaggaa
aaagtggctcaccaactcagaagagaaattgaaattcaatcacatttgagacataagaat
attcttcgtctgtatggctatttctatgatgaaaagaaagtttatctgatattggaatat
gctccaggtggagaaatgtatcacttccttcagaaatgtactagattttcagaagaacaa
acttccaaattcatgtatcaaatggccagagctttgaaatattgttctgcaaaacatgtt
atccatcgtgatatcaaaccagaaaatctcttattggatggcaatggtgaattgaagatt
gcagattttggttgggctgttcatgctccaacaagtagaagaaagacactttgtggtaca
ttggactatttacctccagaaatgattgagaagaaagctcacaatgcaactgtagatttg
tggtgtattggagttctgtgttatgaatttttaacaggaaatccaccattctttgcacaa
gatgataagtcaaccatgagaaatattgttgctgtaagatattccttccctgaatacgta
ggagatgaggcaaaagatttagtaagaaaacttcttgttaaggagccatccaatcgtatc
acacttgaacaagttctcaaacatcctttcattattacatacaataagaataaggacgaa
atgtaa

DBGET integrated database retrieval system