KEGG   Naegleria gruberi: NAEGRDRAFT_34873Help
Entry
NAEGRDRAFT_34873  CDS       T01241                                 

Definition
profilin
Orthology
K05759  
profilin
Organism
ngr  Naegleria gruberi
Brite
Exosome [BR:ngr04147]
 Exosomal proteins
  Proteins found in most exosomes
   NAEGRDRAFT_34873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 132 aa AA seqDB search
MSWTPFVDSQFVAPSNGLIQKGLIMGRDGTIWGVTDGWAVTAQEAKNLAGQVANPSSVPA
TGITLGGVKYMGLVADEENFQGFSSTKKQGVSGVVLKSAVIVGSFSEPHKNPNAYSFLKG
VADSLVNAGTLQ
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggactcctttcgttgactctcaattcgttgctccatcaaatggtttgatccaa
aagggtttgatcatgggtagagatggtactatctggggtgttactgatggttgggccgtc
actgctcaagaagctaagaatttggctggtcaagttgctaatccatcttctgttcctgct
actggtattactttgggtggtgtcaaatatatgggtttggttgctgatgaagaaaacttc
caaggtttctcttccacaaagaagcaaggcgtatcaggagttgtcttgaagtcagctgtc
attgttggtagtttttctgaaccacacaagaatccaaatgcttactcattcttgaagggt
gttgctgattcattggtcaatgctggtactttgcaataa

DBGET integrated database retrieval system