KEGG   Naegleria gruberi: NAEGRDRAFT_34993Help
Entry
NAEGRDRAFT_34993  CDS       T01241                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ngr  Naegleria gruberi
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ngr00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 588 aa AA seqDB search
MCGITFVLRYLTEKASQDQRQEALEEVRALSKLLVHRGPIESDIKVWPLSTAKESYACMA
HERLSIIDLTTGKQPILSQDETCAVIHNGEIYNHDDIDAELKKEGFQYRTHSDSECILHL
YEQAKKKRIEKGQVDPLTVITIQDAVEFVSKLDGYFATVVYDSVTQTLVAARDRIGIKPL
YMGRKKNVDGQMDSVWFASEMKVLSAAGCYEIDTFLPGMVYLQHSSQEFGVIEQYYNPIW
FDSKVYNKPEETDLVKIREGFEAAVKKRMMSDVELGVFLSGGLDSSLVAALVKKYTNQPR
LHSFSIGIGANESSDLVAARKVAAHLGTVHHEHIFAIDEGIAALEKVVYHLESYDVTTVR
ATTPMFLLSHLASQYIRVILSGEGSDEMFGGYVYFRDAKDSQQLQDEMVTKVRNLHLADV
MRCDRATMAHGLEARVPFLDKDFLDTVMTIHPDHKLHHYHGTDGEEHNMEKFVLRKAFDG
LDLIPDEILWRTKVQFGDGVGHGWIDSLKEFCDKQVTDEDFAKAAERFPYNTPISKEAYY
YRTLFEKHFPSDICAKTCKKWLPWSKYEVDPSGRFQLSEIKKLNQDSQ
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattacctttgttttgagatatctcactgaaaaagctagtcaagatcaaaga
caagaagcgttggaagaagttcgtgccttatccaaattgctcgttcacagaggaccaatt
gaatctgatattaaagtatggcctctttccactgccaaggaatcctatgcttgtatggct
catgaacgtttgtccattattgatcttactactggtaaacaaccaattctttcacaagat
gaaacttgtgctgtcattcacaatggtgaaatttataaccatgatgacattgatgctgaa
ttgaaaaaggaaggattccaataccgtactcattccgattctgaatgtattcttcacttg
tacgaacaagctaaaaagaagagaattgaaaaaggtcaagtcgatccattgactgttatt
accattcaagatgctgttgaatttgtttccaaattggatggttactttgctactgttgtc
tatgactctgttactcaaaccttggttgctgctcgtgaccgtattggtatcaagcctctc
tacatgggtagaaagaagaatgttgatggacaaatggacagtgtctggtttgcctctgaa
atgaaagttttgagtgcagctggctgttatgaaattgataccttcttaccaggtatggtc
tatcttcaacattcttctcaagaatttggtgttattgaacaatattataacccaatttgg
tttgatagcaaggtttacaacaagccagaagaaactgatttggtcaagattagagaaggt
tttgaggctgctgttaagaagagaatgatgtctgatgttgaattgggagtctttttgagt
ggtggtttggactcctcacttgttgctgctcttgttaaaaagtatactaaccaacctcgt
ttgcacagtttctcaattggtattggtgcaaatgaaagttccgatttggttgctgccaga
aaggttgctgctcacttgggcactgttcaccatgaacacattttcgctattgacgaaggt
attgctgctttggaaaaggttgtctatcacttggaatcttatgatgtcactactgttaga
gctactacaccaatgttcttgctctctcacttggcttctcaatacattcgtgttatcttg
tctggtgaaggaagtgatgaaatgtttggtggttatgtctatttcagagatgccaaggac
tctcaacaattacaagatgaaatggttactaaggttagaaacttgcacttggctgacgtt
atgagatgtgatagagctaccatggctcatggtttggaagctagagttccattcttggat
aaggactttttggatactgtcatgactattcatccagatcataaattgcatcactaccat
ggtactgatggtgaggaacacaatatggaaaagtttgttcttagaaaggcctttgatgga
ttggatttgattcctgatgaaattttgtggagaactaaggttcaatttggtgatggtgtt
ggtcacggttggattgactctttgaaggaattctgtgacaagcaagtcactgacgaagac
tttgctaaggctgctgaaagattcccttacaatactccaatttctaaggaagcttactat
tatagaaccttgttcgaaaagcacttcccatctgatatttgtgccaagacttgcaagaag
tggttgccatggagtaagtatgaagtcgatcctagcggtagattccaattgtctgaaatc
aagaagctcaaccaagattcccaataa

DBGET integrated database retrieval system