KEGG   Naegleria gruberi: NAEGRDRAFT_35141Help
Entry
NAEGRDRAFT_35141  CDS       T01241                                 

Definition
(RefSeq) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ngr  Naegleria gruberi
Pathway
ngr00010  Glycolysis / Gluconeogenesis
ngr00260  Glycine, serine and threonine metabolism
ngr01100  Metabolic pathways
ngr01110  Biosynthesis of secondary metabolites
ngr01130  Biosynthesis of antibiotics
ngr01200  Carbon metabolism
ngr01230  Biosynthesis of amino acids
Module
ngr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAEGRDRAFT_35141
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NAEGRDRAFT_35141
Enzymes [BR:ngr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NAEGRDRAFT_35141
Membrane trafficking [BR:ngr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    NAEGRDRAFT_35141
Exosome [BR:ngr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NAEGRDRAFT_35141
  Exosomal proteins of melanoma cells
   NAEGRDRAFT_35141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1 Membr_traf_MHD
Motif
Other DBs
NCBI-GeneID: 8852595
NCBI-ProteinID: XP_002682122
JGI: Naegr1_35141
AA seq 250 aa AA seqDB search
MVYKIVLIRHGESEWNKENRFTGWYDCGLSETGLKEAVEAGQILSKEGYQFDVCYTSLLK
RAIKTLWIVLETMDMMYLPVSKSWRLNERHYGALQGLNKAQTAEKHGEEQVKVWRRSYDI
PPPALEVSDERYPGHERKYSSLTEEELPKTESLALTVDRVIPYWNDVIAPSVKEGKKVLV
AAHGNSLRALVKYLDNIPNEEIVELNIPTGVPLVYELDENLKPIKHYYLGDQEAIQQKIN
SVASQAKKKE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggtttataaaattgtattaattagacacggtgaatcagaatggaacaaggaaaataga
tttactggttggtatgattgtggtttgagtgaaacaggattgaaggaagctgtagaagct
ggtcaaattttgagcaaagaaggctatcaatttgatgtttgttatacaagtttattaaaa
cgtgccatcaagacattgtggattgtattggaaactatggatatgatgtatttaccagtt
agtaagagttggagattgaatgaaagacattatggtgctcttcaaggattaaacaaggct
caaacagctgaaaaacatggtgaagaacaagttaaagtttggagaagatcctacgatatt
ccaccaccagcacttgaagtttctgatgaaagatatccaggacatgaaagaaaatactca
tcattgactgaagaagaattaccaaagactgaatcacttgctttaactgttgatagagtt
attccatattggaatgatgttattgctccatctgttaaggaaggaaagaaagttctcgtt
gctgctcatggtaattctcttcgtgctttggttaaatatttagataacattccaaatgaa
gaaattgttgaattgaatattccaactggtgttcctttggtttatgaattagatgaaaat
ttgaaaccaatcaaacattactatttgggtgatcaagaagctattcaacaaaagattaat
agtgtcgcttctcaagcaaagaagaaggaataa

DBGET integrated database retrieval system