KEGG   Naegleria gruberi: NAEGRDRAFT_35141Help
Entry
NAEGRDRAFT_35141  CDS       T01241                                 

Definition
phosphoglycerate mutase 1
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ngr  Naegleria gruberi
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NAEGRDRAFT_35141
   01230 Biosynthesis of amino acids
    NAEGRDRAFT_35141
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAEGRDRAFT_35141
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NAEGRDRAFT_35141
Enzymes [BR:ngr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NAEGRDRAFT_35141
Exosome [BR:ngr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NAEGRDRAFT_35141
  Exosomal proteins of melanoma cells
   NAEGRDRAFT_35141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 250 aa AA seqDB search
MVYKIVLIRHGESEWNKENRFTGWYDCGLSETGLKEAVEAGQILSKEGYQFDVCYTSLLK
RAIKTLWIVLETMDMMYLPVSKSWRLNERHYGALQGLNKAQTAEKHGEEQVKVWRRSYDI
PPPALEVSDERYPGHERKYSSLTEEELPKTESLALTVDRVIPYWNDVIAPSVKEGKKVLV
AAHGNSLRALVKYLDNIPNEEIVELNIPTGVPLVYELDENLKPIKHYYLGDQEAIQQKIN
SVASQAKKKE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggtttataaaattgtattaattagacacggtgaatcagaatggaacaaggaaaataga
tttactggttggtatgattgtggtttgagtgaaacaggattgaaggaagctgtagaagct
ggtcaaattttgagcaaagaaggctatcaatttgatgtttgttatacaagtttattaaaa
cgtgccatcaagacattgtggattgtattggaaactatggatatgatgtatttaccagtt
agtaagagttggagattgaatgaaagacattatggtgctcttcaaggattaaacaaggct
caaacagctgaaaaacatggtgaagaacaagttaaagtttggagaagatcctacgatatt
ccaccaccagcacttgaagtttctgatgaaagatatccaggacatgaaagaaaatactca
tcattgactgaagaagaattaccaaagactgaatcacttgctttaactgttgatagagtt
attccatattggaatgatgttattgctccatctgttaaggaaggaaagaaagttctcgtt
gctgctcatggtaattctcttcgtgctttggttaaatatttagataacattccaaatgaa
gaaattgttgaattgaatattccaactggtgttcctttggtttatgaattagatgaaaat
ttgaaaccaatcaaacattactatttgggtgatcaagaagctattcaacaaaagattaat
agtgtcgcttctcaagcaaagaagaaggaataa

DBGET integrated database retrieval system