KEGG   Naegleria gruberi: NAEGRDRAFT_35722Help
Entry
NAEGRDRAFT_35722  CDS       T01241                                 

Definition
calcineurin regulatory subunit B
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ngr  Naegleria gruberi
Brite
Protein phosphatases and associated proteins [BR:ngr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     NAEGRDRAFT_35722
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 177 aa AA seqDB search
MGTNTSSLRPEEVEEMQKGTNFTQKEIKKLYKRFKKLDKDGNGTISKDEFLMIPELAVNP
LVKRVISIFDENGDGSVNFKEFIAALSVFNAQGDKQRKLEFAFKVYDIDGDGYISNGELF
TVLKMMVGNNLSDVQLQQIVDKTILEADEDGDGKISFEEFAKTLSHQDLENKMTIRL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgggaactaataccagctcgttgagaccagaagaagtcgaagagatgcaaaagggtact
aactttacccaaaaggaaattaaaaagttatacaagagattcaagaagcttgataaggat
ggtaacggaactatatcaaaggatgaatttttgatgatacctgaacttgcagtcaatccc
cttgtgaaaagagttatatctatattcgatgaaaacggtgatggatccgtaaactttaaa
gaatttattgctgcactctcggtattcaatgctcaaggtgataagcaaaggaaacttgaa
tttgctttcaaagtatacgatattgatggagatggttacataagtaacggagaacttttc
acagttttgaaaatgatggttggtaataaccttagtgatgtacaattgcaacaaattgtc
gataaaacaattttggaagctgatgaagatggtgatggtaaaattagctttgaagaattt
gccaagacactatcacatcaagatttggaaaataagatgaccattcgtttgtaa

DBGET integrated database retrieval system