KEGG   Naegleria gruberi: NAEGRDRAFT_35731Help
Entry
NAEGRDRAFT_35731  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ngr  Naegleria gruberi
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NAEGRDRAFT_35731
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NAEGRDRAFT_35731
Enzymes [BR:ngr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NAEGRDRAFT_35731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 163 aa AA seqDB search
MSTDSDFYSFTVKDADLNDVSMADYKGKVVMIVNVASRCGFTKQYDEIQEVYNKYKDQGF
EVLAFPCNQFGSQEPGTNEEICTFARTKFKVTFKIFDKINVNGSETIPLYNFLKKEGAGF
LVDAVKWNFTKFLVSKSGKVLKRYAPNTSPKDMEDDIQKLLKE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactgactctgatttttattcatttactgtcaaggatgctgatttaaatgatgta
tctatggctgattataaaggaaaagtagtaatgattgtgaatgttgcctctagatgtggt
ttcaccaaacagtacgacgaaattcaagaagtttataacaagtataaggatcaaggtttt
gaagtattggcattcccatgcaatcaattcggatctcaagaacctggcaccaatgaagaa
atctgcacatttgccagaaccaaattcaaagtcaccttcaaaatatttgacaagattaat
gtcaatggatccgaaactattccactttacaatttcctaaagaaggaaggtgctggtttt
ctcgttgatgcagtaaaatggaattttaccaagtttctcgtttcaaagagtggaaaagta
ttgaaacgatatgctccgaatacttctccgaaagatatggaagatgatattcaaaaattg
ttaaaggaataa

DBGET integrated database retrieval system