KEGG   Naegleria gruberi: NAEGRDRAFT_39324Help
Entry
NAEGRDRAFT_39324  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
ngr  Naegleria gruberi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 828 aa AA seqDB search
MSQSHVDVSSLKFDFSRINIPTSHTPIHKEECCLSFDSPKSEGGINVCLNTFLAFSPKYT
RRHHQLTGNTVFLNIKKIKKEKPIEEKSEDQPTKMAIGVEGGFQIKEEEENDEKLYDELL
SLVLLEPNNVVIPLPNNDLPEKVKLSIKGILENQSAERKQEVLKWEGEELTESKHTMELK
QIGNIKVPAHGWKCAECDITDNLWLNLSDGHIGCGRKFWDGTGGNNHAVEHYQKTGFPVC
VKLGTIQLDDNGEPKADVYSYAEDKMVKDSKLVEHLEYFGINIREMKKTTKTMAEMELDQ
NLNFDFTRIQESDKHLQPMYGPGFTGLKNIGNSCYLASVMQTLFSFPEVQERYHDKELSC
YTGSSSLDTFSLQMAKLANGLLSGDYSKSEEHVDSFQEGIPPRSFKNVVGKGHPEFSTMR
QQDAVEFYQHLLQLIEREDKRINCTDSVNSIFNYNVEERIECSETSKVKYTYRKDNLISL
PVPLSEATNKAEYEEFCKQEKERERIEKELKLAENINSKPLSTSTEKKQQIRPMIPMSKC
IEAFAETEPVDHFYSSALGRNTIGLKQTSLATFPQYLAVQVRKFILDGWVPKKLDVFITD
AEEIDITHLRGTGLKPNEQELPSDEKKTESIFVDMQIVQSLVEMGIPENRAKRGAWKSNN
KGVNEAMEWVFEHCDDPEIDNPLPEAKQEKSSSGNAPSADAIESLANLGFPSTHAVVALK
QTQNNIERAAEWLFSHMDDMDSYLNEASNEKPAEKKEEEYLDGSGKYELVGFISHMGSNT
SCGHYVCHLKKDVGNGEKRWVLFNDSKVLQSENTPFDMGYLYFYKRKN
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaatcccacgttgatgtttcttctttaaagtttgattttagcaggatcaatatt
ccaactagtcatactccaattcataaggaagaatgttgtctttcttttgattcaccaaaa
tcggaaggaggaatcaatgtttgtttgaatacattcttggctttctctccaaagtacaca
agaagacatcatcaattaactggtaatactgtattcttgaatattaaaaagatcaagaag
gaaaagcctattgaagaaaaatctgaagatcaaccaaccaaaatggctattggtgttgaa
ggaggattccaaatcaaagaagaggaagaaaatgacgaaaaactttatgatgaattgttg
tcacttgtattattagaaccaaataatgttgtaataccattaccaaataatgatttacct
gagaaagttaaactttcaattaaaggtattttggaaaaccaatctgcagaacgtaaacaa
gaagttctcaaatgggaaggtgaagagttaactgaatctaaacatactatggagcttaaa
caaattggaaatattaaagtcccagctcatggatggaagtgtgctgagtgtgatatcaca
gataatctttggttgaatctttctgacggtcatattggatgtggtagaaaattctgggat
ggtactggtggtaataatcatgctgttgaacattatcaaaagactggattccctgtttgt
gtcaaattgggaactattcaattggatgataacggagaaccaaaggctgacgtatattca
tatgctgaagataagatggttaaggattccaagcttgttgaacatttggaatattttgga
attaatatcagagaaatgaagaaaacaactaaaactatggctgaaatggaattggaccaa
aatttgaactttgattttactagaattcaagaatctgataagcatttgcaaccaatgtat
gggccaggttttactggtttgaagaacattggtaattcttgctatttggctagtgtcatg
caaactcttttctcattcccagaagttcaagaaagatatcacgataaggaattgtcttgt
tatacaggatctagttcattggatactttctctcttcaaatggcaaaactcgctaatgga
ttactttctggagattattccaagtcagaagagcacgtcgattcattccaagaaggtatt
ccaccaagatcattcaagaatgttgttggaaagggccatccagagttcagcactatgaga
caacaagatgctgtagaattttaccaacacttactccaattaatcgaaagagaagacaag
agaattaactgtacagactctgtaaatagtattttcaattacaatgtggaagaaagaatt
gaatgctcagaaacatctaaggttaaatatacttacagaaaggataatttgatttcactc
ccagttccactttctgaagcaaccaataaggcagaatatgaagagttctgtaaacaagag
aaggaaagagaaagaatagaaaaagaactcaaattggctgagaatataaacagcaagcct
ttgagtacaagtactgaaaagaaacaacaaattagaccaatgattccaatgtctaagtgt
attgaagcctttgctgagacagaacctgttgatcatttctatagctctgcccttggaaga
aatactattggcttgaaacaaactagtcttgcaactttcccacaatatttggctgttcaa
gtaagaaagtttattttagatggatgggttccaaagaaattggatgtatttattactgat
gctgaagagattgatattactcatctcagaggaactggacttaaaccaaatgaacaagaa
cttccaagtgatgaaaagaagacagaatccatttttgttgatatgcaaatcgttcaatct
ttggtagaaatgggaattccagaaaatagagctaagagaggtgcttggaaatccaacaat
aagggtgtcaatgaggctatggaatgggtatttgagcattgtgatgatcctgaaattgat
aatccacttcctgaagctaaacaagaaaagagctcatcaggaaatgctccttctgctgat
gccattgaatcactagctaatcttggtttcccttccactcatgctgttgttgctttaaag
caaactcaaaacaatattgaaagagctgctgaatggctcttcagtcatatggatgatatg
gacagttatcttaatgaagcttctaatgaaaaaccagctgaaaagaaagaagaagagtat
ttggatggaagtggaaagtatgaacttgttggtttcattagtcatatgggttcaaatact
tcatgtggtcactatgtttgccatctcaagaaggatgttggaaatggtgaaaagagatgg
gttttgtttaatgatagcaaagttttacaaagtgaaaacacacctttcgatatgggctac
ctctacttctataaacgaaagaattaa

DBGET integrated database retrieval system