KEGG   Naegleria gruberi: NAEGRDRAFT_44881Help
Entry
NAEGRDRAFT_44881  CDS       T01241                                 

Definition
ERG4/ERG24 ergosterol biosynthesis family protein
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
ngr  Naegleria gruberi
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    NAEGRDRAFT_44881
Enzymes [BR:ngr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     NAEGRDRAFT_44881
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 450 aa AA seqDB search
MNSQLSPERSLKKDEPKLSWLHTHVAPLFLMLVTPPCAFLYWYTCEHLGGSVIALFNMFG
KEGIINSIVSIVQPYILGSKVAWAIIVVFSILQLTLMKVLPGKKFNGPMTPKGNLPVYTD
NGLLAYLITIMLFFLCSSTGLNLFPSSILYNHFPYLIGALNIFSLVFCLFLQIKGMYFPS
STDCGSNEGNFIMDYYWGTELHPVVFGFDVKVFTNCRFGMMSWPLLILSFAAKQYEVTGQ
LSDSMIINLVIQFIYLTKFYMWESGYLCSIDIMHDRAGYYICWGCLVWVPSVYTSTSLYI
SKYPNNLGPYWTAFILIGGASAVILNYLADIQRQNVRKANGKCLVWGKKPALIEGEIIAE
NGDKKKFILLICGFWGITRHFHYVMELLGTFFWTVPALFNNFLPYFYLFFLTILLFHRAE
RDQKRCSKKYGKYWEEYCRRVPYKVIPYVF
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaactcacaattatctcctgaacgaagcttaaagaaagatgagccgaagctctcttgg
ctgcacactcacgttgcaccattgtttttaatgctcgtcactccaccttgtgctttttta
tattggtacacttgcgaacaccttggtggctctgtcattgctctttttaatatgttcgga
aaggaaggtatcattaactctatcgtctccattgttcagccttatattttaggatctaag
gttgcttgggcaattattgtggtgttctctattttgcaattaacattgatgaaagttttg
ccaggaaaaaagtttaatggcccgatgactcctaaaggaaatctaccagtctacacagac
aatggattattagcttatttaattaccattatgctattcttcctttgctcaagcactggt
cttaatttattcccttcctcaattctttataaccattttccatacttgattggagccttg
aacattttcagtttggttttttgtctcttccttcaaatcaaaggcatgtatttcccaagc
agcacagattgtggctcaaatgaaggaaatttcattatggattactattggggaactgaa
ttgcatccagttgtttttggttttgatgttaaggtctttacgaattgtagattcggaatg
atgagctggcctttacttattttatcatttgctgccaaacaatacgaagtcactggtcaa
cttagcgactctatgatcattaatttggttattcaattcatctaccttaccaagttttac
atgtgggaaagtggctacttgtgctcaattgatattatgcatgatagagctggttattac
atttgttggggatgtttagtgtgggtaccatctgtttacacttccacatccttgtacatt
tccaagtatccaaacaatttgggcccttattggactgcattcatcttgattggaggtgct
tcagcagtcatccttaactatttggcagatatccaacgtcaaaatgtacgtaaggcaaac
ggaaaatgccttgtttggggaaagaaaccagcactcattgagggtgaaatcattgctgaa
aatggagataagaaaaagttcatcttgttaatatgtggtttttggggtatcaccagacat
tttcattatgttatggaattgctgggaacatttttctggactgttccagcactgttcaat
aacttcttgccatacttttatttatttttcttaacaatattgttgttccatagagcagaa
agagaccagaagagatgtagcaagaagtatggtaaatattgggaagaatattgcagacga
gttccatacaaggtaattccttatgtattttag

DBGET integrated database retrieval system