KEGG   Naegleria gruberi: NAEGRDRAFT_46282Help
Entry
NAEGRDRAFT_46282  CDS       T01241                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ngr  Naegleria gruberi
Pathway
ngr00220  Arginine biosynthesis
ngr00330  Arginine and proline metabolism
ngr01100  Metabolic pathways
ngr01110  Biosynthesis of secondary metabolites
ngr01130  Biosynthesis of antibiotics
ngr01230  Biosynthesis of amino acids
Module
ngr_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    NAEGRDRAFT_46282
   00330 Arginine and proline metabolism
    NAEGRDRAFT_46282
Enzymes [BR:ngr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     NAEGRDRAFT_46282
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase UPF0489 CtIP_N
Motif
Other DBs
NCBI-GeneID: 8852411
NCBI-ProteinID: XP_002681279
JGI: Naegr1_46282
AA seq 332 aa AA seqDB search
MVRNQQYEDEDSVNQSVVILESWCSVGQRREGVERGAFHLLDTQQLNHLPIIRIDQENSS
STTSSPDSALCNRAIVAEEEICHNQRRVASFNQQIAQTIDNLFNTTSEKKPFIVNIGGDH
SVAIGSIYAMMKQYPDLRVLWVDAHADINTPKGSMSKNMHGMPLAFLCGESILGQERKSL
VGFEWMNEEISLDVSSRLAYLGLRDVDDFEHGILEKFNIKHFTASQIHQFGIGNCLEECF
THLNLKNSQLPLFLSFDVDGIDPEFTPSTGTAVENGISHQDGIMICKKCGEYSNFVGMDL
VEVNPSIGDEEQVEKTILNSMHYITTAVERRL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggtgaggaatcaacaatacgaagatgaggacagtgtcaatcaaagtgttgttattttg
gagagttggtgctccgtgggacagagaagagaaggtgttgagagaggagcttttcattta
cttgacacacaacaattaaatcacttgccgatcattagaatcgatcaggagaatagtagt
agcacaacaagtagtccagacagtgctttgtgcaatagagcaattgttgcggaagaggag
atttgtcataatcagaggagggttgcttctttcaatcaacaaattgctcaaacaattgat
aatttatttaacacaacgagtgagaagaaaccttttattgtaaatattggtggagatcat
tcagttgccattggttcaatttatgcaatgatgaagcaatatccagatttgagagtattg
tgggtggatgcacatgcagacattaatacaccaaaaggttcaatgagtaagaacatgcat
ggaatgccacttgcttttctctgtggagaatcaattttaggtcaagaaagaaaatcactt
gttggttttgaatggatgaatgaagagattagtcttgatgtttcttctcggttagcctat
cttggtcttcgagatgttgatgattttgaacatggaatcttggaaaaattcaatatcaaa
catttcacagcaagccaaattcatcaatttggaattggtaattgcttggaagaatgtttt
actcatttgaatttgaaaaacagtcaacttcctttatttttgagttttgacgtggatggc
atagatccagaattcacacctagcactggaactgcagtggagaatggaatttcacatcaa
gatggaataatgatttgtaaaaagtgtggagaatattctaattttgtaggaatggatttg
gttgaggtaaatccatcgattggtgatgaagaacaagtggaaaagacaatactaaattcc
atgcattacattacaactgcagttgaacgaagattatag

DBGET integrated database retrieval system