KEGG   Naegleria gruberi: NAEGRDRAFT_48457Help
Entry
NAEGRDRAFT_48457  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
ngr  Naegleria gruberi
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    NAEGRDRAFT_48457
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    NAEGRDRAFT_48457
Enzymes [BR:ngr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     NAEGRDRAFT_48457
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 866 aa AA seqDB search
MTTSITNANSFDNNPINRLQHSLNKLFNNSTKIDEKWLRKILELHDEEKSEGLASSLTQE
EIRKEIELIIGPENEWRFDSEQAQQFREKCIKLREKSVEEMDIIDVISNQKTISYDFKYE
RDQTQYVHPVENDTNMTQYLNLWDLVQPTRVEIIGIENLNIQPEKSQSGNSYLYICCELF
HGGTPLTKGRFTRMIPLHTSPQWNQFVIFNDVLLCDLPRETKICFTIFSRQMNETDQSLD
SPNCISGKDTPLGYVIIPMFDFKGLLKQGEFHSIMKPNGRAMPYSIPIENIGNETSIFIN
YRLDSHSDSVVFPQGKPPKRMEECLDSFEQNIKEFFKDLPQEEQLNQIINQIITRDSLQN
LTQEERWLLWSNREVLIEIPKALPKFILSVPWKMPHAVHIAHSLLSIWKPISPLDALELL
SYKFADSKVRQYAIERLDELDDAQLSDFLLQLVQSLKYEPYHDSSLSRFLLERSLRSPHT
IGHFVFWHLKADMHVPSFKERFCLILEEYLSNSGNHRRELLKQVFVLDQLLEISIKIKQE
KLEDCKSTFEKLINNVKLPKKFKLPISPHMEVTEIIPHKCKFMDTKHRGLWLCFKNADKR
GDNIHIIFKAGDDLRSDQLIVQLLRVMDKLWKKEGLDLHLKPYASICTGELIGMIEIVKN
SETVAHIVKGSGHGIARVFNSDIIHDWLKMHNHREDEWNGIVDNFVRSCAAYCPATYVLG
VGDRHNDNIMVTRKGDLFHIDFTYFLGCFRYHFVRESTPFIFNPMHSHVMGGENSEMFEK
FCELSCQSYACLCKYGQVIITLFILMLGADIPHLKSIENVMWLKKSLMLNGSKEYTDKHF
RSQIKESMRQSRARIGDAIHIFPIKR
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgacaacatcaataaccaatgctaactcatttgacaataacccgatcaatagattgcaa
cactctctcaacaaattatttaataattcaacaaaaattgatgaaaaatggttacggaaa
attttggaacttcacgatgaagagaaaagtgaaggattagcgagctcattaacacaagag
gaaattagaaaggaaattgaattaattattggtccagagaatgaatggagatttgattct
gaacaagctcaacaattccgtgaaaaatgtataaaattgagagaaaaatcagtggaagaa
atggatataatagatgtcatctctaatcaaaaaactatttcttatgatttcaaatatgaa
agggatcaaactcaatatgttcatcccgtagaaaatgatactaatatgacacaatatttg
aatttatgggatttagttcaacctacaagagttgaaattattggaattgaaaatcttaat
attcaacctgaaaaatctcaaagtggaaattcctatttatatatctgttgtgaattattt
catggtggaactccacttactaaaggaagatttaccagaatgattcctcttcacacctct
cctcagtggaatcaatttgttattttcaatgatgttttactttgtgatcttccaagagaa
acaaaaatttgctttacaatattttcaagacaaatgaatgaaacagaccagtcattggat
tcacctaattgtattagcggtaaagacactcctcttgggtatgtcattatcccaatgttt
gactttaaggggttattgaaacagggtgaatttcattctataatgaaaccaaatgggaga
gcaatgccatatagtataccaattgagaatattggaaatgaaacatcaatttttattaat
tatcgactagatagccattcggattctgtggtctttccccaaggaaaacctccaaagagg
atggaagaatgccttgattcatttgaacaaaatattaaggaatttttcaaagatttacca
caggaagaacaattgaatcaaatcattaatcagataattactcgagactctcttcaaaat
ctaacacaggaggaaagatggttgctatggtcaaatagagaagtacttattgaaatacct
aaagctttacccaagtttattttgagcgtaccatggaagatgccacacgctgttcatatt
gctcattcattgctttctatatggaaaccaatttccccactggatgcattagaattattg
agctacaaatttgcagattctaaggtcagacaatatgccattgaaagacttgacgaactt
gatgatgctcaattgagtgattttttacttcaattagttcaatctctaaaatatgaacca
tatcatgatagcagtctttccagatttttgctagagagaagtttgagatctccacatact
attggccactttgtcttttggcatttgaaagccgatatgcatgtcccctcattcaaagag
agattctgtctgatattggaagaatacttatcgaattcgggcaatcacagaagagaatta
ttgaaacaggtctttgttttggatcaattactggaaatttccattaaaatcaagcaagaa
aagttggaggattgtaaatcaacatttgaaaaattaattaacaatgtcaaactacctaaa
aaattcaagctaccaatatcaccacatatggaagtcacagaaatcattccacacaaatgt
aaattcatggatactaaacacagaggtttgtggctctgtttcaagaatgcagacaaaaga
ggagataatatccatataatctttaaggcaggtgatgacctacgttcggatcaattgatt
gtgcaacttttacgagttatggataaattgtggaagaaggaaggtctagatctccatttg
aaaccctatgctagtatttgtacaggtgaattgattggaatgattgaaattgttaagaat
agtgaaacagttgcacatatagtaaagggctctggacatggcatagcacgggttttcaat
tcagatataattcatgactggctcaagatgcacaaccacagagaagatgaatggaatgga
attgttgataattttgttaggtcatgtgcagcttattgtccagctacctatgttttgggt
gttggtgacagacacaatgataacattatggtgacaaggaagggagatttgtttcacatt
gatttcacttactttttaggctgctttaggtatcattttgtgcgagaatctactcctttc
atattcaatccaatgcattctcatgtcatgggaggtgaaaatagtgaaatgtttgagaaa
ttctgtgaattgagttgtcagtcatatgcttgtttatgtaaatatggtcaagtgataata
actttatttatattaatgttgggtgctgatattccacatttgaaaagtattgaaaatgtt
atgtggttgaagaagagcttaatgttgaatggatcaaaggaatatacagacaaacatttc
cgttcccagattaaggaaagtatgcggcagtctcgtgcacgaattggtgatgcaatacat
atttttccaatcaaaagatga

DBGET integrated database retrieval system