KEGG   Naegleria gruberi: NAEGRDRAFT_50931Help
Entry
NAEGRDRAFT_50931  CDS       T01241                                 

Definition
cyclin box fold domain-containing protein
Orthology
K06634  
cyclin H
Organism
ngr  Naegleria gruberi
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    NAEGRDRAFT_50931
  Replication and repair
   03420 Nucleotide excision repair
    NAEGRDRAFT_50931
Transcription machinery [BR:ngr03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     NAEGRDRAFT_50931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 330 aa AA seqDB search
MMEASFSSSSSSVASPFANSSQKLFWIFKEKEEMIRVRDNAKLRVQKEILDLQEKYTDKK
LVADDLLTPEEESIIVQKYCGILFEISTQLGYPLHVKATALSFMKRFYLKHSVMEYDIVF
MMLTCIFLATKTEEKFVALANFLEKVNEIVSDASSLTTQIIFKYELVLLQGLEFHLMVYH
PYRSLYAYVHDLHDVGGDAIYMDAQTKITEIIKMTDAIFLFSPSVVALGSLYMTHPDITK
NFISKMFKEQEVQLMNQINQLCEMAATPVEKSKVKTADKKLKKIRKFLKPQLEELEEQYS
KQIAEEQRVRREQKYQHRDRQQQEEQRKFL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagcatcgttttcatcctcttcatcatcagtagcatctccattcgccaactct
agtcagaaattattttggatatttaaagaaaaggaggaaatgattagagtacgtgataat
gctaaacttcgggttcaaaaagaaatattggatcttcaagaaaagtatactgataaaaag
ttggttgctgatgatctgctaacaccagaagaagaatctattattgtacaaaaatattgt
ggaattttgtttgaaatttctacacaactgggttatccattacacgtaaaggcaacagct
ttatcctttatgaaaagattttatttgaaacattctgttatggaatatgatattgtattt
atgatgttaacatgtattttcttggcaaccaagacagaggaaaagtttgttgctcttgcc
aattttttggaaaaggtgaatgaaattgtttctgatgcttcaagcttaactacacaaatc
attttcaaatatgaacttgtattacttcaaggattagaattccatttaatggtttatcat
ccatatcgttcactttatgcatatgttcacgatttacatgatgttggaggtgatgctatt
tatatggatgctcaaacaaaaattacagaaattatcaaaatgacagatgcaatcttttta
ttttctccttctgtggttgctcttggtagtttgtatatgacacatccagatattacaaag
aattttatttcaaaaatgtttaaagaacaagaggttcaattaatgaatcaaattaatcaa
ttgtgtgaaatggctgctacacctgtggaaaaatcaaaagtaaagacagccgataagaaa
ttaaagaaaattagaaagttcttaaaacctcaattagaagaattagaggaacaatacagc
aaacaaattgcagaagaacaacgagtaagaagagaacaaaagtatcaacacagagataga
caacaacaagaggaacaaagaaaatttttgtaa

DBGET integrated database retrieval system