KEGG   Naegleria gruberi: NAEGRDRAFT_51654Help
Entry
NAEGRDRAFT_51654  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
ngr  Naegleria gruberi
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ngr00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ngr00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 528 aa AA seqDB search
MDQSGRVILVHNGVIENSGELKKELIEKHGIKFKSETDTEVIVQMIGVYLDQMLKDGMKQ
DVVEKAVLKTTKHLEGTWGLVIMSTVEPDRLVVARNGSPLLVGVSQGKMFVASESSAFGL
YTREMISLENNEIAVITSEGVTLPYERKIVVEEEKIEKTPHPHAHWTIREILEQPESISR
SLNFGGRISDDSHVKLGGLDDNKEWLSGIEHLVIAGCGTSYYAGLYGAQIFRDLRCFKTI
QVIDGAELEESHFCPENSGLLVLSQSGETADVLRCIYIAEQLSVPSFSCVNRVGSTIART
TKCGVYINAGRETAVASTKAFSCQVTVLALIGLWFAQNRSPKFQLQHRQAIIQYLHRLPT
SAGMVLSRVREKCRHIARHIYNMKGNTLFMLGKGYGEAVAYEGSLKVKEVTYTHAEGYSS
GALKHGPFALIEPGTVIFVFILDDKYFKMNMTAAAEIKSRGAYTVAITDIPDKIPSHEAD
YVIDVPSNGIFSALLANIPLQLVAYELALLRGHDPDKPRNLAKTVTVL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggatcaatctggtcgtgtgattcttgttcacaatggtgtcattgaaaattctggtgaa
ttgaaaaaggaattgatagaaaagcacggaattaaattcaagagtgaaacagatactgaa
gttattgttcaaatgattggtgtctatttggaccaaatgttaaaggatggaatgaagcaa
gatgttgttgaaaaggccgttctcaagactactaaacatttggaaggtacttggggtttg
gttattatgtctacagttgaaccagatcgtttggttgtagccagaaatggttctcctctc
ttggtcggtgtttcacaaggtaagatgtttgttgcttccgaaagttctgcattcggattg
tacactagagaaatgatcagtttggaaaataatgaaattgctgtcattacctctgaaggt
gttactcttccttatgaaagaaagattgttgttgaagaagaaaagattgaaaagactcct
catccacatgctcactggactattcgtgaaattttggagcaacctgaatcaatttcaaga
tctttgaattttggtggtagaattagtgatgatagtcatgttaaattgggtggtttggat
gataataaggaatggttatctggtattgaacatttggttattgctggttgtggtactagt
tactatgctggtctctatggtgctcaaattttcagagatttgagatgcttcaagactatc
caagttattgatggtgctgaacttgaggaatcacatttttgccctgaaaattctggcctt
ttggttttatcacaaagtggtgaaacagctgatgttttgagatgtatttatattgcagaa
caattgagcgttccaagcttctcctgcgttaatcgtgtcggttcaactattgctagaact
acaaagtgtggtgtgtatattaatgctggtcgtgaaactgctgttgcctcaaccaaggca
ttctcttgccaagttactgttttggcattgattggtttgtggtttgctcaaaacagatca
ccaaaattccaacttcaacatcgtcaagccattattcaatacctccatcgtttgccaact
agtgcaggtatggttttgagcagagttagagagaagtgtagacatattgccagacatatt
tataacatgaagggcaatactcttttcatgttgggtaagggttatggtgaagctgttgct
tatgaaggatctttgaaggttaaggaagttacttacactcacgccgaaggttactcatct
ggtgccttgaaacatggtccattcgcccttattgaaccaggaactgttatttttgttttc
attcttgatgacaagtactttaagatgaatatgacagctgctgctgaaatcaaatcaaga
ggtgcttatactgtagctattactgatattccagataagattccatcccatgaagctgac
tatgttattgatgttccatctaatggtattttcagtgccttgttggccaatattccactc
caattggttgcttacgaattggctcttctccgtggtcacgatccagacaaaccaagaaat
ttggccaagactgtcactgttctttaa

DBGET integrated database retrieval system