KEGG   Naegleria gruberi: NAEGRDRAFT_53412Help
Entry
NAEGRDRAFT_53412  CDS       T01241                                 

Definition
(RefSeq) hypothetical protein
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
ngr  Naegleria gruberi
Pathway
ngr00500  Starch and sucrose metabolism
ngr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NAEGRDRAFT_53412
Enzymes [BR:ngr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     NAEGRDRAFT_53412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cellulase
Motif
Other DBs
NCBI-GeneID: 8863403
NCBI-ProteinID: XP_002670625
JGI: Naegr1_53412
AA seq 296 aa AA seqDB search
MPGRYGYDYIYPSASDISLYVATMNLNVIRLPFKWDRLQPKHGQPLDSLELARIDAVVSV
CATHGVSVLLDPHNYGYSVNGLIGTSDEPTENFTDFWIRLAQHYLGYDNVIFGIMNEPHT
HTPLQWADIAQTTLNAIRSTGATQLVLVPGTFYTGAHSWTSNVLGQSNAEALKNIKDSAN
NFMFEMHQYLDSDNSGTHSTCVSSTIGSTRLKTTTDWLRQNGFKAFLGEFGASDDTVCMQ
ALYDILQFMGNNTDVWHGWTYWNASPWSTTYIYAAYPPDENQHPQVSILKEAMGVV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtcgttacggctacgattatatctatccatctgcctctgatattagtttatat
gttgccacaatgaatttgaatgtaattcgtcttcctttcaaatgggatagacttcaaccg
aaacatggtcaaccattagattctttggaattagcaagaatagacgcagttgtttcagta
tgtgctactcatggggtgtctgttctattggaccctcataattatggatattctgtgaat
ggattgattggcacgtcagatgagccaactgaaaatttcacagatttttggattcgtcta
gctcagcattatttaggatatgataatgtgatttttggaattatgaatgaaccgcataca
catacaccacttcaatgggcagatattgctcaaacaactttgaatgctattaggtcaact
ggtgctactcaattggttcttgttcctggaactttttatactggagctcattcttggaca
tctaatgttcttggacaatcaaatgcagaagcattgaagaatattaaggattctgccaat
aatttcatgtttgaaatgcatcaatatttagacagtgacaattcaggaactcattcgaca
tgtgtcagctcaacaattggttcgacaagattgaaaactactactgattggttacgtcaa
aatggatttaaggcatttttaggtgaatttggagcttctgatgatacagtttgcatgcaa
gctctttatgacattttgcaatttatgggaaataatactgacgtttggcatggatggact
tattggaatgcttctccatggagtacaacttatatttatgctgcttatccccctgatgag
aatcaacatcctcaagtttcaatcttgaaagaagcaatgggagtagtttaa

DBGET integrated database retrieval system