KEGG   Naegleria gruberi: NAEGRDRAFT_53412Help
Entry
NAEGRDRAFT_53412  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ngr  Naegleria gruberi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ngr00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 296 aa AA seqDB search
MPGRYGYDYIYPSASDISLYVATMNLNVIRLPFKWDRLQPKHGQPLDSLELARIDAVVSV
CATHGVSVLLDPHNYGYSVNGLIGTSDEPTENFTDFWIRLAQHYLGYDNVIFGIMNEPHT
HTPLQWADIAQTTLNAIRSTGATQLVLVPGTFYTGAHSWTSNVLGQSNAEALKNIKDSAN
NFMFEMHQYLDSDNSGTHSTCVSSTIGSTRLKTTTDWLRQNGFKAFLGEFGASDDTVCMQ
ALYDILQFMGNNTDVWHGWTYWNASPWSTTYIYAAYPPDENQHPQVSILKEAMGVV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtcgttacggctacgattatatctatccatctgcctctgatattagtttatat
gttgccacaatgaatttgaatgtaattcgtcttcctttcaaatgggatagacttcaaccg
aaacatggtcaaccattagattctttggaattagcaagaatagacgcagttgtttcagta
tgtgctactcatggggtgtctgttctattggaccctcataattatggatattctgtgaat
ggattgattggcacgtcagatgagccaactgaaaatttcacagatttttggattcgtcta
gctcagcattatttaggatatgataatgtgatttttggaattatgaatgaaccgcataca
catacaccacttcaatgggcagatattgctcaaacaactttgaatgctattaggtcaact
ggtgctactcaattggttcttgttcctggaactttttatactggagctcattcttggaca
tctaatgttcttggacaatcaaatgcagaagcattgaagaatattaaggattctgccaat
aatttcatgtttgaaatgcatcaatatttagacagtgacaattcaggaactcattcgaca
tgtgtcagctcaacaattggttcgacaagattgaaaactactactgattggttacgtcaa
aatggatttaaggcatttttaggtgaatttggagcttctgatgatacagtttgcatgcaa
gctctttatgacattttgcaatttatgggaaataatactgacgtttggcatggatggact
tattggaatgcttctccatggagtacaacttatatttatgctgcttatccccctgatgag
aatcaacatcctcaagtttcaatcttgaaagaagcaatgggagtagtttaa

DBGET integrated database retrieval system