KEGG   Naegleria gruberi: NAEGRDRAFT_53883Help
Entry
NAEGRDRAFT_53883  CDS       T01241                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
ngr  Naegleria gruberi
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:ngr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ngr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ngr00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 333 aa AA seqDB search
MVKIGINGFGRIGRLVFRASLERTDVEVVAINDIMMTPEYMIYMIKYDTVHGKFHGKLEH
TEKSIIVNGREIHVLCERDPEQLPWGQHNVEYVVESTGIFTKLDSAAKHLKGGAKRVVIS
APADTPTFVMGVNNHEYKPEMTVINNASCTTNCLAPIAAVLHENFGIVEGLMTTVHAVTA
TQPTVDAPSRKDWRGGRAAGYNIIPSSTGAAKAVGLVIPSLNGKLTGMAFRVPTVDVSVV
DLTCRLEKPATKKQIDEAMKAASESERFKGILKFTDEEVVSSDFVHDSASSTYDSKASIC
LNEHFVKVVAWYDNEWGYSNRVLDLIKSTAKIQ
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagattggtattaacggtttcggtagaattggtagattggttttccgtgcttca
ttggaaagaactgatgtcgaagttgttgccattaacgatattatgatgactccagaatac
atgatctacatgatcaagtatgatactgtccacggtaaattccatggtaagctcgaacat
actgaaaagtctatcattgtcaatggtcgtgaaatccacgttttgtgtgaaagagatcct
gaacaattaccatggggacaacacaatgttgaatatgttgttgaatccactggtattttc
accaaattggactctgctgccaagcacttgaagggtggtgctaagagagttgttatttct
gctcctgctgatactccaacatttgttatgggtgtcaataaccatgaatataagccagaa
atgactgtcattaacaatgcttcttgtactactaactgtttggctccaattgctgctgtt
ttgcacgaaaactttggtattgttgaaggtttgatgaccactgtccacgctgttactgct
actcaaccaactgttgatgctccatctagaaaggattggagaggtggtcgtgctgctggt
tacaatatcattccatcttcaactggtgctgctaaggctgtcggtttggttattccatca
ttgaatggtaaattgactggtatggctttcagagttccaactgttgatgtttccgttgtt
gatttgacttgtagattggaaaagccagctactaagaagcaaattgatgaagctatgaag
gctgcttctgaatctgaaagattcaagggtattttgaagttcactgatgaagaagttgtt
tctagcgatttcgtccatgattctgcttcatccacttatgatagcaaggcttcaatttgt
ttgaatgaacactttgttaaggttgttgcttggtacgataacgaatggggttactctaac
agagttttggatttgatcaagtctactgctaagatccaataa

DBGET integrated database retrieval system