KEGG   Naegleria gruberi: NAEGRDRAFT_55119Help
Entry
NAEGRDRAFT_55119  CDS       T01241                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ngr  Naegleria gruberi
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NAEGRDRAFT_55119
Enzymes [BR:ngr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     NAEGRDRAFT_55119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 205 aa AA seqDB search
MSTSTASTLQLFRPIVICGPSGVGKGTLIQKLFKEYPNIFGFSVSHTTRGPRPGEENGVH
YYFSTKEIMQKEIDEGKFIEHANVHGNLYGTSFQAVKEVQTKGKCCVLDIDIQGARQVRN
NKELNPLVLFVKPPSMDILEQRLRGRATETEESIQLRLKNARKELEEFEQDNTNLFDDSV
ENNDLDESYASLKLTIKKHIPTIQL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccagtactgcttcaactttgcaactttttagacctattgttatttgtggccca
agtggtgtcggtaaaggaacacttattcaaaaattgttcaaggaatatccaaacattttc
ggtttttcagtctctcatacaactcgtggaccaagaccaggagaagaaaatggagtgcac
tattactttagtacaaaggaaataatgcaaaaggaaattgatgaaggtaaatttattgaa
catgcaaacgtgcacggaaacttgtacggaacaagctttcaagctgtaaaggaagttcaa
accaaaggaaaatgttgtgtcctcgacattgatattcaaggagccagacaagtaagaaac
aataaggaattaaatcctcttgttttgtttgtcaagccaccaagcatggatattttggaa
caaagattgagaggaagagctactgaaactgaggaaagcattcaacttcgacttaagaat
gccagaaaagaattggaagaatttgaacaagacaataccaatctctttgatgactcagtt
gaaaataacgatttggatgaatcctatgctagtttaaagcttactatcaagaagcacata
ccaacaattcaactttaa

DBGET integrated database retrieval system