KEGG   Naegleria gruberi: NAEGRDRAFT_55595Help
Entry
NAEGRDRAFT_55595  CDS       T01241                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ngr  Naegleria gruberi
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NAEGRDRAFT_55595
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NAEGRDRAFT_55595
  Amino acid metabolism
   00310 Lysine degradation
    NAEGRDRAFT_55595
Enzymes [BR:ngr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NAEGRDRAFT_55595
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 369 aa AA seqDB search
MIKVPSMGDSISSGEINEWVKKPGQACVEDEVICTIDTDKVSVEIRAPEAGVLKAILANA
KDTVEVGKDIAIIDTDGKPTATPAAAASTPSTTTTTTTTASTPSTPTPTATPTPTPKKEE
AKPTQSSAPTTSANGLARTERRVKMTRIRAKIAERLKQAQNTYAMLTTFNEIDMKKIMEL
RKVNQDDFQERHDGLKLGFMGAFCKAASIALTEVPAVNGVIDGNEVVYRDYVDISVAVAT
PNGLVVPVVRNCESKSIAQIERDISNLGEKARKNAISLDDMQGGTFTISNGGVFGSLMGT
PIINPPQSAILGMHATKNRPIAIGDQVVVRPMMYVALTYDHRIIDGREAVTFLKRVKELI
EDPEKMLLF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgataaaggttccatcaatgggtgattccatctcatcaggtgaaatcaatgaatgggtg
aaaaaaccaggtcaagcttgtgttgaagatgaagtcatttgtactattgatactgataag
gtctctgtggaaatccgtgctccagaagctggtgttttgaaggctattttggctaatgcc
aaggataccgttgaagttggtaaggatattgccatcattgatactgatggtaagccaact
gctacacctgctgctgctgcttccactccttctactactacaacaacaacaacaactgct
tccactccttctactccaactcctactgccacaccaacaccaaccccaaagaaggaagaa
gctaaaccaacacaatcatcagctccaactacttctgccaatggactcgctagaactgaa
agaagagttaaaatgacacgtattcgtgctaagattgctgaacgtttgaagcaagcccaa
aacacctatgctatgttgaccactttcaatgaaattgacatgaagaagattatggaattg
agaaaggttaaccaagacgatttccaagaacgtcacgatggtttaaagttgggtttcatg
ggtgctttctgtaaggctgcttctattgctcttactgaagttccagctgtcaatggtgtc
attgatggtaatgaagttgtttatcgtgattatgtcgatattagtgttgctgttgccact
ccaaatggtttggtcgttccagttgtcagaaactgtgaaagcaagtcaattgcacaaatt
gaaagagacatttctaacttgggtgaaaaggccagaaagaatgccatctcccttgatgat
atgcaaggtggtactttcactatttctaatggtggagttttcggaagtttgatgggtaca
ccaattatcaatcctccacaatctgctattttgggaatgcacgccacaaagaatagacca
attgctattggtgatcaagttgttgtcagaccaatgatgtacgttgccttgacttatgac
cacagaattatcgatggtagagaagctgttactttcttgaagagagttaaggaattgatc
gaagatccagaaaagatgttgctcttctaa

DBGET integrated database retrieval system