KEGG   Naegleria gruberi: NAEGRDRAFT_55595Help
Entry
NAEGRDRAFT_55595  CDS       T01241                                 

Definition
(RefSeq) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ngr  Naegleria gruberi
Pathway
ngr00020  Citrate cycle (TCA cycle)
ngr00310  Lysine degradation
ngr01100  Metabolic pathways
ngr01110  Biosynthesis of secondary metabolites
ngr01130  Biosynthesis of antibiotics
ngr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NAEGRDRAFT_55595
  Amino acid metabolism
   00310 Lysine degradation
    NAEGRDRAFT_55595
Enzymes [BR:ngr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NAEGRDRAFT_55595
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl DUF1525 Hamartin NAM-associated Lamp
Motif
Other DBs
NCBI-GeneID: 8855156
NCBI-ProteinID: XP_002682037
JGI: Naegr1_55595
AA seq 369 aa AA seqDB search
MIKVPSMGDSISSGEINEWVKKPGQACVEDEVICTIDTDKVSVEIRAPEAGVLKAILANA
KDTVEVGKDIAIIDTDGKPTATPAAAASTPSTTTTTTTTASTPSTPTPTATPTPTPKKEE
AKPTQSSAPTTSANGLARTERRVKMTRIRAKIAERLKQAQNTYAMLTTFNEIDMKKIMEL
RKVNQDDFQERHDGLKLGFMGAFCKAASIALTEVPAVNGVIDGNEVVYRDYVDISVAVAT
PNGLVVPVVRNCESKSIAQIERDISNLGEKARKNAISLDDMQGGTFTISNGGVFGSLMGT
PIINPPQSAILGMHATKNRPIAIGDQVVVRPMMYVALTYDHRIIDGREAVTFLKRVKELI
EDPEKMLLF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgataaaggttccatcaatgggtgattccatctcatcaggtgaaatcaatgaatgggtg
aaaaaaccaggtcaagcttgtgttgaagatgaagtcatttgtactattgatactgataag
gtctctgtggaaatccgtgctccagaagctggtgttttgaaggctattttggctaatgcc
aaggataccgttgaagttggtaaggatattgccatcattgatactgatggtaagccaact
gctacacctgctgctgctgcttccactccttctactactacaacaacaacaacaactgct
tccactccttctactccaactcctactgccacaccaacaccaaccccaaagaaggaagaa
gctaaaccaacacaatcatcagctccaactacttctgccaatggactcgctagaactgaa
agaagagttaaaatgacacgtattcgtgctaagattgctgaacgtttgaagcaagcccaa
aacacctatgctatgttgaccactttcaatgaaattgacatgaagaagattatggaattg
agaaaggttaaccaagacgatttccaagaacgtcacgatggtttaaagttgggtttcatg
ggtgctttctgtaaggctgcttctattgctcttactgaagttccagctgtcaatggtgtc
attgatggtaatgaagttgtttatcgtgattatgtcgatattagtgttgctgttgccact
ccaaatggtttggtcgttccagttgtcagaaactgtgaaagcaagtcaattgcacaaatt
gaaagagacatttctaacttgggtgaaaaggccagaaagaatgccatctcccttgatgat
atgcaaggtggtactttcactatttctaatggtggagttttcggaagtttgatgggtaca
ccaattatcaatcctccacaatctgctattttgggaatgcacgccacaaagaatagacca
attgctattggtgatcaagttgttgtcagaccaatgatgtacgttgccttgacttatgac
cacagaattatcgatggtagagaagctgttactttcttgaagagagttaaggaattgatc
gaagatccagaaaagatgttgctcttctaa

DBGET integrated database retrieval system