KEGG   Naegleria gruberi: NAEGRDRAFT_55909Help
Entry
NAEGRDRAFT_55909  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
ngr  Naegleria gruberi
Brite
Enzymes [BR:ngr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     NAEGRDRAFT_55909
Protein kinases [BR:ngr01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   NAEGRDRAFT_55909
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 351 aa AA seqDB search
MNTESEAPRRDYDITQSGSFTKGEFKINMSWKNMSLNDLETLHMLGKGSSGNVYLVSHKA
SGQFLALKYISVFDDQKRKTIINELQTLYTASSEFLIGFFGAFYQEGNIQIALEYMEGGS
LSDIIKTVQGPIQEKFLARIIQQVCLGLKYLHKERHLVHRDLKPGNILFNTKGQFKISDF
GVSAELDNTGAECGSFVGTVTYMRLEGKKYSFASDIWALGIIVLESVTGKFPFRDEQDEA
IGVFWELLNTIKTKEPPSISTNMGYSKDVCDFIALCLQKDPKQRATVSDLLEHPFISKHC
THTPTSASEWQQYNNWINQLVKIRSQTEKSAQLDQNIKTQSLENKLKAMVL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggagagtgaagctccaagaagagattacgatattacgcaatcgggtagtttt
actaagggagaatttaaaattaatatgagttggaagaatatgtctttgaatgatttggaa
actttgcatatgctcggaaagggatcatcaggcaatgtttatttggtttctcataaagca
tcgggacagttccttgctttgaaatacatttctgtttttgatgatcaaaagagaaagaca
attattaacgaattacaaactctgtataccgcttcatcagaatttctgattgggtttttc
ggtgcattctatcaggaaggaaatattcaaattgctttagagtacatggaaggaggatca
ttgagtgatattataaagactgttcaaggaccaattcaagagaaattcttggccagaatt
atacaacaagtatgtttgggattgaagtacttgcacaaggaacgtcacttggtacacaga
gatttaaagccaggtaatattctttttaatactaagggacaatttaagatttcagatttt
ggagtcagtgctgagcttgataatacaggtgcagaatgtggatcatttgttggaactgtt
acctatatgagattggaaggaaaaaagtattcatttgctagtgatatctgggctttgggt
attattgttttggaatctgtcacaggtaaattcccattcagagatgaacaagatgaagct
attggagttttctgggaattattgaatacaatcaagacgaaggaaccaccatccatctct
acaaacatgggctactcaaaggatgtttgtgattttattgctctctgccttcaaaaggat
ccaaaacaaagagccactgtttctgatttattggaacacccattcatttccaagcattgc
acacatacaccaacaagtgcatctgaatggcaacaatataacaattggataaatcaactc
gtcaagattcgttctcaaactgaaaaatcagctcaattagatcaaaacataaagactcaa
agtcttgagaataaactaaaagccatggtgttgtaa

DBGET integrated database retrieval system