KEGG   Naegleria gruberi: NAEGRDRAFT_56375Help
Entry
NAEGRDRAFT_56375  CDS       T01241                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ngr  Naegleria gruberi
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    NAEGRDRAFT_56375
Enzymes [BR:ngr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     NAEGRDRAFT_56375
Protein phosphatases and associated proteins [BR:ngr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     NAEGRDRAFT_56375
Transcription machinery [BR:ngr03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     NAEGRDRAFT_56375
Spliceosome [BR:ngr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    NAEGRDRAFT_56375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 310 aa AA seqDB search
MSTPTTPTADIDIDAIIFKLLEVRGSRPGKQVSLTENEIKQLILKSREIFISQPALLELE
APIKICGDVHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPE
NFFLLRGNHECASINRIYGFYDECKRRYSIRLWKSFTDCFNCMPVAAIIDEKIFCMHGGL
SPELHNMEQIRKVMRPTDVPDSGLLCDLLWSDPEEGIQGWGENDRGVSFTFGNDVVEKFL
KKHDLDLVCRAHQVVEEGYKFFAKRQLVTIFSAPNYCNEFDNAGAMMSVDETLMCSFQIL
KPAVKKSYYY
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtctacacctacaacaccaacggctgatatcgacattgatgccatcatctttaaattg
ttggaagttagaggttctcgaccaggaaaacaagtgagtctaactgaaaacgaaattaaa
caattaatattaaaatctagggaaattttcatatctcagcctgctttgctggaactcgaa
gcacctattaaaatttgtggagatgtccatggacaatactatgatcttttgagattgttc
gaatacggaggtttcccaccagaagcaaattatctctttttgggagattacgtagacaga
ggaaagcaatccttggaaactatttgccttttgcttgcctacaaaattaaatatccagaa
aatttcttccttttgagaggtaatcacgaatgcgcttccatcaacagaatttatggtttt
tatgacgaatgtaaaagaagatactccataagattatggaagagctttactgattgcttc
aactgcatgcctgttgctgctattattgatgaaaagattttctgtatgcacggtggttta
tcgccagaacttcacaatatggaacaaattagaaaggttatgcgtccaactgatgttcca
gatagtggcttgttgtgtgatttgttgtggagtgatccagaagaaggcatacaaggatgg
ggagaaaatgatagaggtgtttctttcacatttggtaatgatgttgtagaaaaattcctg
aaaaaacatgatttggatcttgtctgtcgtgctcaccaagtcgtagaagaaggatacaaa
ttctttgccaagaggcaattggtgacgattttcagtgctccaaattactgtaacgaattc
gataatgcaggtgcaatgatgtctgtcgatgagactttgatgtgctcattccagattttg
aagcctgctgtcaagaagagttattattattaa

DBGET integrated database retrieval system