KEGG   Naegleria gruberi: NAEGRDRAFT_57827Help
Entry
NAEGRDRAFT_57827  CDS       T01241                                 

Definition
disulfide isomerase family protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ngr  Naegleria gruberi
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ngr04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 476 aa AA seqDB search
MKSIIIAILIALFACTFVFAQDSVVDLTSKNFEEKLQEKEFALIEFFAPWCGHCKKLVPE
YNKLAEKFATNEKVNIFKVNGDQESDVMSKFEIQGFPTIKLFKNGKFFRDYDGERTADAI
ASWLHKKTGPVSIPIESAEALDQLKASSKVIVVGFVSSKTSETYKKFLQAADDKDLEEFI
VAEVVDNAELNAKFDIKQDSVVVIRDFDATPAVSTDFDAIATFVKDNGYPLVDEVSGATF
QRFVDKALPIGVLFIDFSNAETKQKHVEELNEIAQSFKGKVSLGYSDAAVYGGQLEVMGG
KKDAIPGFAVMDLETRSNYPLNIDTVNKEEIIAFLTKVLAGEVPKFLRSQEIPEENNEAV
KVVVGKSFDDLVINNDNDVLLEFYAPWCGHCKSLEPKYTQLAEELKSVSGLVIAKIDASE
NDTPINIEGFPTIYFFPKGGKASPVLYEGDRTVESLKTFLQKNAVGAVFTEKKDEL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcattatcatcgcaatcttgattgctctctttgcttgcacttttgtgtttgca
caagattctgttgttgatcttacatcaaagaactttgaagaaaagttacaagaaaaggaa
tttgccttgattgaattctttgctccatggtgtggtcattgtaagaaattggtccctgaa
tataataagctcgctgaaaagtttgctaccaatgaaaaggttaacattttcaaggttaat
ggtgaccaagaatctgatgtcatgtctaagtttgaaattcaaggtttcccaactatcaag
ttgttcaagaatggtaaattcttcagagattatgatggtgaacgtactgctgatgctatt
gcttcttggttgcacaagaagactggtcctgtcagtattccaattgaatctgctgaagct
ttggatcaattgaaggcttcctctaaggttattgttgttggtttcgtttcatcaaagact
tctgaaacctacaagaagttcctccaagctgctgatgataaggatttggaagaattcatt
gttgctgaagttgttgacaatgctgaattgaatgccaaattcgatattaagcaagattct
gttgttgttatcagagattttgatgctactcctgctgtttctactgatttcgatgctatt
gccacttttgtcaaggataatggttatccattggttgatgaagttagtggtgctactttc
caaagatttgttgataaggctttgccaattggtgtccttttcattgatttctccaatgct
gaaactaaacaaaagcacgttgaagaattgaacgaaattgctcaatcattcaagggtaag
gtttcattgggttactctgatgctgctgtttatggtggtcaattggaagttatgggtggt
aagaaggatgccattccaggtttcgctgtcatggatttggaaactagatcaaactatcca
ctcaatattgatactgttaataaggaagaaatcattgctttccttaccaaggttttggct
ggtgaagttccaaagttcttgagatctcaagaaattccagaagaaaacaatgaagctgtt
aaggttgttgtcggaaagtcatttgatgatttggttattaacaatgataatgatgttttg
ctcgaattctatgctccatggtgtggtcactgtaagtcactcgaaccaaagtacactcaa
ttggctgaagaattgaagtctgtctctggtttggttattgccaagattgatgcttctgaa
aatgatactccaatcaacattgaaggtttcccaaccatttacttcttccctaagggtggt
aaggcttctccagttttgtatgaaggtgatagaactgttgaaagcttaaagactttctta
caaaagaatgctgttggtgctgttttcactgaaaagaaggacgaattgtaa

DBGET integrated database retrieval system