KEGG   Naegleria gruberi: NAEGRDRAFT_57827Help
Entry
NAEGRDRAFT_57827  CDS       T01241                                 

Definition
disulfide isomerase family protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ngr  Naegleria gruberi
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    NAEGRDRAFT_57827
Enzymes [BR:ngr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NAEGRDRAFT_57827
Exosome [BR:ngr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NAEGRDRAFT_57827
  Exosomal proteins of colorectal cancer cells
   NAEGRDRAFT_57827
  Exosomal proteins of bladder cancer cells
   NAEGRDRAFT_57827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 476 aa AA seqDB search
MKSIIIAILIALFACTFVFAQDSVVDLTSKNFEEKLQEKEFALIEFFAPWCGHCKKLVPE
YNKLAEKFATNEKVNIFKVNGDQESDVMSKFEIQGFPTIKLFKNGKFFRDYDGERTADAI
ASWLHKKTGPVSIPIESAEALDQLKASSKVIVVGFVSSKTSETYKKFLQAADDKDLEEFI
VAEVVDNAELNAKFDIKQDSVVVIRDFDATPAVSTDFDAIATFVKDNGYPLVDEVSGATF
QRFVDKALPIGVLFIDFSNAETKQKHVEELNEIAQSFKGKVSLGYSDAAVYGGQLEVMGG
KKDAIPGFAVMDLETRSNYPLNIDTVNKEEIIAFLTKVLAGEVPKFLRSQEIPEENNEAV
KVVVGKSFDDLVINNDNDVLLEFYAPWCGHCKSLEPKYTQLAEELKSVSGLVIAKIDASE
NDTPINIEGFPTIYFFPKGGKASPVLYEGDRTVESLKTFLQKNAVGAVFTEKKDEL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcattatcatcgcaatcttgattgctctctttgcttgcacttttgtgtttgca
caagattctgttgttgatcttacatcaaagaactttgaagaaaagttacaagaaaaggaa
tttgccttgattgaattctttgctccatggtgtggtcattgtaagaaattggtccctgaa
tataataagctcgctgaaaagtttgctaccaatgaaaaggttaacattttcaaggttaat
ggtgaccaagaatctgatgtcatgtctaagtttgaaattcaaggtttcccaactatcaag
ttgttcaagaatggtaaattcttcagagattatgatggtgaacgtactgctgatgctatt
gcttcttggttgcacaagaagactggtcctgtcagtattccaattgaatctgctgaagct
ttggatcaattgaaggcttcctctaaggttattgttgttggtttcgtttcatcaaagact
tctgaaacctacaagaagttcctccaagctgctgatgataaggatttggaagaattcatt
gttgctgaagttgttgacaatgctgaattgaatgccaaattcgatattaagcaagattct
gttgttgttatcagagattttgatgctactcctgctgtttctactgatttcgatgctatt
gccacttttgtcaaggataatggttatccattggttgatgaagttagtggtgctactttc
caaagatttgttgataaggctttgccaattggtgtccttttcattgatttctccaatgct
gaaactaaacaaaagcacgttgaagaattgaacgaaattgctcaatcattcaagggtaag
gtttcattgggttactctgatgctgctgtttatggtggtcaattggaagttatgggtggt
aagaaggatgccattccaggtttcgctgtcatggatttggaaactagatcaaactatcca
ctcaatattgatactgttaataaggaagaaatcattgctttccttaccaaggttttggct
ggtgaagttccaaagttcttgagatctcaagaaattccagaagaaaacaatgaagctgtt
aaggttgttgtcggaaagtcatttgatgatttggttattaacaatgataatgatgttttg
ctcgaattctatgctccatggtgtggtcactgtaagtcactcgaaccaaagtacactcaa
ttggctgaagaattgaagtctgtctctggtttggttattgccaagattgatgcttctgaa
aatgatactccaatcaacattgaaggtttcccaaccatttacttcttccctaagggtggt
aaggcttctccagttttgtatgaaggtgatagaactgttgaaagcttaaagactttctta
caaaagaatgctgttggtgctgttttcactgaaaagaaggacgaattgtaa

DBGET integrated database retrieval system