KEGG   Naegleria gruberi: NAEGRDRAFT_58772Help
Entry
NAEGRDRAFT_58772  CDS       T01241                                 

Definition
cytochrome p450
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
ngr  Naegleria gruberi
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    NAEGRDRAFT_58772
  Amino acid metabolism
   00380 Tryptophan metabolism
    NAEGRDRAFT_58772
Enzymes [BR:ngr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     NAEGRDRAFT_58772
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     NAEGRDRAFT_58772
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 1075 aa AA seqDB search
MSTQNNEAQCPFASADSRRNSKGSNGSNQPCKEEPIPQPEPHFLVGNIFTVDKKNPFPSF
IELAKKFDGIFKMNILGKQLVVVYSQELVNELCDESRFEKALPPGLKHVKEFGGDGLFTA
ENNEPNWAIAHRILMPAFGPKSIQDMYPQMYDIAEQLCTKWERLGEHSVIDIVDNMTRLT
LDTIALCAFNYRFNSFYHNEMHPFVQSMFEALQEASSRTKRPSILNNVLVKTKKKHQRNI
EYMHAVADEIVKDRKKNPSDVNDLLNRMLLGKDPVTNQGLSDENIRYQMVTFLIAGHETT
SGLLSFTLYELLKHPEVLKKAQKEVDTVIGNENIQIKHIPQLVYLDQILKETLRLWPTAP
GFGLGCKTDQVIGGKYRIHPSDFIIVSNSNLHRDKKVWGEDCEQFNPDRMSPENFSSLPS
NSWKPFGNGSRGCIGRPFAWQEAILVLAMVLQRFELIENDPNYHLSITQALTIKPNGLFL
KVKPRSNWKGSQLVRTNASNTSSENSHTDDQNSTSTESKGPLLVLYGSNSGTCESFASML
HQDAKSKGFDCKVGRLNTFTGNIPLDTPILIVTASYEGQPTEDAKQFVGWLEHVPENTLK
GLKYAVFGCGHSDWVDTYQRIPTFIDNKLSEAGGERIAQRGIGNAAKDLFCEFDQWRKTL
WSSFDPHTSHELPPVETTIIKGHRETILHFQSLEPGKVIENYDLVPEDYCDDHGTCRSKR
HIEIQLPAGAHYESGDYLSVLPVNSMKVVNKALSHFKLTHDDQIVLKRSETISSSSYPVN
EPISAVNLFMNYFELSQPATKRQLEILLEHTKEASDKQVLQQLIEKDSNIPPILDIVHDL
KSCTIPLGNFLDISIPMRTRQYSISSSPLWNKDKCTITVGVLRAPATHGKGFHEGVASNF
LASCLPDMQVSVQIRNSSFKLPNDPSVPIIMIGAGTGIAPFRGFVQERACLIKEGKTLGK
ALLFQGCRNPEQDYLYKKELEEWSQLGAVELRPVFSRMGSNVKYVQDKIMECKEEVAKLL
LEEAQIYICGEGNHMAPAVKKVLMEIYQQVTNCTKEEAEKRMSSMDKRFAVDVFA
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atgagcactcaaaataatgaagctcaatgtccatttgcttctgctgattctcgtcgtaat
agtaaaggaagcaatggcagtaatcaaccatgtaaagaagaaccaattcctcaaccagaa
ccacactttctcgttggtaatatctttacagtcgataaaaagaatccatttccaagtttt
attgaattggccaaaaagttcgatggtattttcaagatgaatatattaggtaaacaatta
gtagtagtttacagtcaagaattggtcaatgaattatgtgatgagagcagatttgaaaag
gcacttcctccaggattaaaacacgttaaagagtttggtggggatggtttattcactgca
gagaataatgaaccaaattgggctattgctcacagaattttaatgccagcctttggtcca
aaatcaattcaggatatgtatcctcaaatgtatgatattgcagaacaattgtgtaccaaa
tgggaaagattgggagagcactcagttattgacattgttgataacatgaccagattgacc
ttagatacaattgccttgtgtgcattcaactatagatttaacagtttctatcataatgaa
atgcatccattcgtacagtccatgttcgaggcattgcaagaagccagctctagaactaag
agaccttccattttgaacaatgtcttggtcaagacaaagaaaaagcatcaaagaaatatt
gaatatatgcatgcagttgcagacgagattgtaaaggacagaaagaagaatccaagtgat
gttaacgatttgcttaatagaatgttacttggaaaggatccagtcaccaatcaaggatta
agtgatgaaaatattagatatcaaatggtcacgtttttgatagccgggcacgagacgact
agtggtcttttgagtttcacgctttatgaacttctcaaacatccagaagttttaaagaaa
gctcaaaaagaagttgacactgtgattggaaatgaaaatattcaaatcaaacatattcca
caacttgtctatttggatcaaatcctcaaagaaactcttcgtctgtggccaactgctcct
ggatttggtcttggttgtaaaactgatcaagtcattggtggaaagtatagaattcaccct
tcagattttattattgtgagtaattccaatttgcacagagataagaaagtttggggtgaa
gattgtgaacaattcaatcctgatagaatgagcccagaaaacttttcctcacttccaagt
aacagttggaaaccttttggtaatggatcgagaggttgcattggccgtccatttgcttgg
caagaagcaattttggtattggctatggttcttcaaagatttgaactgattgagaatgat
ccaaattatcacttgtccattacccaagctttgaccatcaagccaaatggattattcctc
aaagttaagccaagatctaattggaaaggatctcaattggtgagaactaatgcttctaat
actagttctgaaaattctcatactgatgatcaaaattccacatctaccgaatcaaagggt
ccacttttggtcttgtacggttctaacagtggtacatgtgaaagctttgcctcaatgttg
caccaagatgctaaatccaaaggatttgattgtaaagttggtagattgaacacatttact
ggtaacattccattggatactccaattctcattgtaacagcttcatatgaaggtcaacca
actgaagatgccaaacaattcgttggatggctcgaacatgttccagaaaatactctcaaa
ggactcaaatatgcagttttcggatgtggacacagtgattgggttgacacctatcaaaga
attccaacattcattgacaacaaattgagtgaagctggtggtgagagaattgcccagaga
ggaattggtaatgctgccaaagacttattctgtgaatttgatcagtggagaaagacattg
tggagttctttcgatcctcatacctctcacgaacttcctccagttgaaacaaccatcatt
aagggacatagagaaacaattctccatttccaaagtttggaacctggaaaggtaattgaa
aattatgatttggttcctgaggactattgtgatgatcatggaacttgtagatccaagaga
catattgaaattcaattgccagctggagctcattatgaatcaggtgattatttatcagta
ttacctgtcaactctatgaaagttgttaataaggcactttctcatttcaaattaactcac
gatgatcaaattgtcttgaagagaagtgaaacaatttcatcttcatcctatcctgtcaat
gagccaatctctgcagtcaacttgttcatgaattatttcgaattgagtcaaccagcaacc
aagagacaattagaaattctcctcgaacacacaaaggaagcatccgataagcaagtactc
caacaattaatagaaaaggactctaacattcctccaattcttgatatcgttcatgatttg
aaatcttgtacaattccactcggaaatttcttggatatttcaattcctatgcgtacaaga
caatactcaatctcatcctctccattgtggaataaggacaagtgtaccattactgttggt
gtattgagagctccagcaacccatggaaaaggattccacgaaggggttgcctccaatttc
ttggcaagttgtcttccagatatgcaagtttcggttcaaattagaaactcttccttcaaa
ttacctaatgacccatctgttccaattatcatgattggagctggtactggtattgctcca
ttcagaggtttcgttcaggaaagagcttgtctcattaaggaaggtaagactcttggtaag
gctctcttgttccaaggatgcagaaatccagaacaagattacttgtacaagaaggaactc
gaagaatggagtcaattgggagctgttgaattgagaccagttttctcaagaatgggaagt
aacgtaaaatatgttcaagataagattatggaatgcaaggaagaagttgctaaactctta
ctggaagaagctcaaatctacatttgtggtgaaggaaatcatatggcacctgctgttaag
aaagtcttgatggaaatttatcaacaagttaccaattgtacaaaggaagaagctgaaaag
agaatgagctcgatggataagcgttttgctgttgatgtttttgcataa

DBGET integrated database retrieval system