KEGG   Naegleria gruberi: NAEGRDRAFT_58772Help
Entry
NAEGRDRAFT_58772  CDS       T01241                                 

Definition
cytochrome p450
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
ngr  Naegleria gruberi
Pathway
Fatty acid degradation
Tryptophan metabolism
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ngr00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:ngr00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 1075 aa AA seqDB search
MSTQNNEAQCPFASADSRRNSKGSNGSNQPCKEEPIPQPEPHFLVGNIFTVDKKNPFPSF
IELAKKFDGIFKMNILGKQLVVVYSQELVNELCDESRFEKALPPGLKHVKEFGGDGLFTA
ENNEPNWAIAHRILMPAFGPKSIQDMYPQMYDIAEQLCTKWERLGEHSVIDIVDNMTRLT
LDTIALCAFNYRFNSFYHNEMHPFVQSMFEALQEASSRTKRPSILNNVLVKTKKKHQRNI
EYMHAVADEIVKDRKKNPSDVNDLLNRMLLGKDPVTNQGLSDENIRYQMVTFLIAGHETT
SGLLSFTLYELLKHPEVLKKAQKEVDTVIGNENIQIKHIPQLVYLDQILKETLRLWPTAP
GFGLGCKTDQVIGGKYRIHPSDFIIVSNSNLHRDKKVWGEDCEQFNPDRMSPENFSSLPS
NSWKPFGNGSRGCIGRPFAWQEAILVLAMVLQRFELIENDPNYHLSITQALTIKPNGLFL
KVKPRSNWKGSQLVRTNASNTSSENSHTDDQNSTSTESKGPLLVLYGSNSGTCESFASML
HQDAKSKGFDCKVGRLNTFTGNIPLDTPILIVTASYEGQPTEDAKQFVGWLEHVPENTLK
GLKYAVFGCGHSDWVDTYQRIPTFIDNKLSEAGGERIAQRGIGNAAKDLFCEFDQWRKTL
WSSFDPHTSHELPPVETTIIKGHRETILHFQSLEPGKVIENYDLVPEDYCDDHGTCRSKR
HIEIQLPAGAHYESGDYLSVLPVNSMKVVNKALSHFKLTHDDQIVLKRSETISSSSYPVN
EPISAVNLFMNYFELSQPATKRQLEILLEHTKEASDKQVLQQLIEKDSNIPPILDIVHDL
KSCTIPLGNFLDISIPMRTRQYSISSSPLWNKDKCTITVGVLRAPATHGKGFHEGVASNF
LASCLPDMQVSVQIRNSSFKLPNDPSVPIIMIGAGTGIAPFRGFVQERACLIKEGKTLGK
ALLFQGCRNPEQDYLYKKELEEWSQLGAVELRPVFSRMGSNVKYVQDKIMECKEEVAKLL
LEEAQIYICGEGNHMAPAVKKVLMEIYQQVTNCTKEEAEKRMSSMDKRFAVDVFA
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atgagcactcaaaataatgaagctcaatgtccatttgcttctgctgattctcgtcgtaat
agtaaaggaagcaatggcagtaatcaaccatgtaaagaagaaccaattcctcaaccagaa
ccacactttctcgttggtaatatctttacagtcgataaaaagaatccatttccaagtttt
attgaattggccaaaaagttcgatggtattttcaagatgaatatattaggtaaacaatta
gtagtagtttacagtcaagaattggtcaatgaattatgtgatgagagcagatttgaaaag
gcacttcctccaggattaaaacacgttaaagagtttggtggggatggtttattcactgca
gagaataatgaaccaaattgggctattgctcacagaattttaatgccagcctttggtcca
aaatcaattcaggatatgtatcctcaaatgtatgatattgcagaacaattgtgtaccaaa
tgggaaagattgggagagcactcagttattgacattgttgataacatgaccagattgacc
ttagatacaattgccttgtgtgcattcaactatagatttaacagtttctatcataatgaa
atgcatccattcgtacagtccatgttcgaggcattgcaagaagccagctctagaactaag
agaccttccattttgaacaatgtcttggtcaagacaaagaaaaagcatcaaagaaatatt
gaatatatgcatgcagttgcagacgagattgtaaaggacagaaagaagaatccaagtgat
gttaacgatttgcttaatagaatgttacttggaaaggatccagtcaccaatcaaggatta
agtgatgaaaatattagatatcaaatggtcacgtttttgatagccgggcacgagacgact
agtggtcttttgagtttcacgctttatgaacttctcaaacatccagaagttttaaagaaa
gctcaaaaagaagttgacactgtgattggaaatgaaaatattcaaatcaaacatattcca
caacttgtctatttggatcaaatcctcaaagaaactcttcgtctgtggccaactgctcct
ggatttggtcttggttgtaaaactgatcaagtcattggtggaaagtatagaattcaccct
tcagattttattattgtgagtaattccaatttgcacagagataagaaagtttggggtgaa
gattgtgaacaattcaatcctgatagaatgagcccagaaaacttttcctcacttccaagt
aacagttggaaaccttttggtaatggatcgagaggttgcattggccgtccatttgcttgg
caagaagcaattttggtattggctatggttcttcaaagatttgaactgattgagaatgat
ccaaattatcacttgtccattacccaagctttgaccatcaagccaaatggattattcctc
aaagttaagccaagatctaattggaaaggatctcaattggtgagaactaatgcttctaat
actagttctgaaaattctcatactgatgatcaaaattccacatctaccgaatcaaagggt
ccacttttggtcttgtacggttctaacagtggtacatgtgaaagctttgcctcaatgttg
caccaagatgctaaatccaaaggatttgattgtaaagttggtagattgaacacatttact
ggtaacattccattggatactccaattctcattgtaacagcttcatatgaaggtcaacca
actgaagatgccaaacaattcgttggatggctcgaacatgttccagaaaatactctcaaa
ggactcaaatatgcagttttcggatgtggacacagtgattgggttgacacctatcaaaga
attccaacattcattgacaacaaattgagtgaagctggtggtgagagaattgcccagaga
ggaattggtaatgctgccaaagacttattctgtgaatttgatcagtggagaaagacattg
tggagttctttcgatcctcatacctctcacgaacttcctccagttgaaacaaccatcatt
aagggacatagagaaacaattctccatttccaaagtttggaacctggaaaggtaattgaa
aattatgatttggttcctgaggactattgtgatgatcatggaacttgtagatccaagaga
catattgaaattcaattgccagctggagctcattatgaatcaggtgattatttatcagta
ttacctgtcaactctatgaaagttgttaataaggcactttctcatttcaaattaactcac
gatgatcaaattgtcttgaagagaagtgaaacaatttcatcttcatcctatcctgtcaat
gagccaatctctgcagtcaacttgttcatgaattatttcgaattgagtcaaccagcaacc
aagagacaattagaaattctcctcgaacacacaaaggaagcatccgataagcaagtactc
caacaattaatagaaaaggactctaacattcctccaattcttgatatcgttcatgatttg
aaatcttgtacaattccactcggaaatttcttggatatttcaattcctatgcgtacaaga
caatactcaatctcatcctctccattgtggaataaggacaagtgtaccattactgttggt
gtattgagagctccagcaacccatggaaaaggattccacgaaggggttgcctccaatttc
ttggcaagttgtcttccagatatgcaagtttcggttcaaattagaaactcttccttcaaa
ttacctaatgacccatctgttccaattatcatgattggagctggtactggtattgctcca
ttcagaggtttcgttcaggaaagagcttgtctcattaaggaaggtaagactcttggtaag
gctctcttgttccaaggatgcagaaatccagaacaagattacttgtacaagaaggaactc
gaagaatggagtcaattgggagctgttgaattgagaccagttttctcaagaatgggaagt
aacgtaaaatatgttcaagataagattatggaatgcaaggaagaagttgctaaactctta
ctggaagaagctcaaatctacatttgtggtgaaggaaatcatatggcacctgctgttaag
aaagtcttgatggaaatttatcaacaagttaccaattgtacaaaggaagaagctgaaaag
agaatgagctcgatggataagcgttttgctgttgatgtttttgcataa

DBGET integrated database retrieval system